[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69009.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  376/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1
:251 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   57->251 1gvhA PDBj 3e-15 33.5 %
:RPS:PDB   29->250 2bgjA PDBj 9e-29 22.3 %
:RPS:SCOP  27->125 1krhA1  b.43.4.2 * 1e-17 24.2 %
:RPS:SCOP  128->250 1fdrA2  c.25.1.1 * 2e-15 22.0 %
:HMM:SCOP  15->129 1i7pA1 b.43.4.2 * 4.3e-26 38.9 %
:HMM:SCOP  114->248 1i7pA2 c.25.1.1 * 2.1e-25 32.8 %
:RPS:PFM   29->124 PF00970 * FAD_binding_6 5e-14 43.6 %
:HMM:PFM   30->124 PF00970 * FAD_binding_6 8.9e-20 36.6 93/99  
:HMM:PFM   135->232 PF00175 * NAD_binding_1 7.5e-08 22.4 98/109  
:BLT:SWISS 48->251 HMP_DEIRA 6e-16 32.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69009.1 GT:GENE BAC69009.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1607578..1608333 GB:FROM 1607578 GB:TO 1608333 GB:DIRECTION + GB:PRODUCT putative oxidoreductase GB:NOTE PF00970: Oxidoreductase FAD-binding domain GB:PROTEIN_ID BAC69009.1 LENGTH 251 SQ:AASEQ MTETFVPPTRFAVPGRIAVSNRAAAVWQTATLTEIRRETPHAATFRFAVPGWQGHLPGQHLMLRLTAEDGYGAQRHYSIASPPEDAGHIELTLDHVEGGEVSGWFHTVAEPGDEVQVRGPLSGFFAWPGDRPALLIGAGSGVVPLMSMVRHHRAQGSTVPLRLLVSARSPQELIYAREYGDETTPVFTRDAAAGVPVGRMSAAHVAPLLDRAPPGGWEAYVCGSNGFAEHASRLLVEAGQPVHRIRIERFG GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 48->251|HMP_DEIRA|6e-16|32.5|197/403| BL:PDB:NREP 1 BL:PDB:REP 57->251|1gvhA|3e-15|33.5|185/396| RP:PDB:NREP 1 RP:PDB:REP 29->250|2bgjA|9e-29|22.3|220/260| RP:PFM:NREP 1 RP:PFM:REP 29->124|PF00970|5e-14|43.6|94/99|FAD_binding_6| HM:PFM:NREP 2 HM:PFM:REP 30->124|PF00970|8.9e-20|36.6|93/99|FAD_binding_6| HM:PFM:REP 135->232|PF00175|7.5e-08|22.4|98/109|NAD_binding_1| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00970|IPR008333| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00970|IPR008333| RP:SCP:NREP 2 RP:SCP:REP 27->125|1krhA1|1e-17|24.2|95/100|b.43.4.2| RP:SCP:REP 128->250|1fdrA2|2e-15|22.0|123/148|c.25.1.1| HM:SCP:REP 15->129|1i7pA1|4.3e-26|38.9|113/125|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 114->248|1i7pA2|2.1e-25|32.8|134/0|c.25.1.1|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 882 OP:NHOMOORG 397 OP:PATTERN --------------------------------------------1----------------------- -2124--1111---42323-26--4A222223487884C7121611-3-11-33313---844-2433431---------------------------------1112---------------------------------------1--11---------------------------------1--------------------------------------1---------11111111111111111-1-----------------------------------------------------------------------1----------1--------------1------------1-----------12--------2-314---111111111111-113-33523425-1--31212133321333-----42-12---1111111161112----------------------------------112-243325335454444533374444258466B761144464252553236-1522--211111111---474--------1-1---------------1-12---------------------------3322-1112-1111------1-11---11-11----212------221212-2221211122-212222222121222222343311--1212222222222222222222222--211111111111---1---------21-221111-1-----------------1-5-54652422443342121-----------11112212122221111111111--------22--------------1-------------------------1--1--------- ----------------1-----------------------------11--1-11----1-------11-----------1-11------21-1-1--------1----1--------------------------------------------------------------------1---------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 95.6 SQ:SECSTR ###########cccccccccccTEEEcEEEEEEEEEEEETTEEEEEEEccTTccccTTcEEEEEEEcTTccEEEEEEEccccTTccEEEEEEEccTTcTHHTHHHHTTccTTcEEEEEEEEEccccGGcccEEEEEEEGGGGHHHHHHTTcHHHHHHccEEEEEEEEccTTTTHHHHHccEEEEEEEccccccccHHHHHHHTHHHHTcccccTTTEEEEEEEcHHHHHHHHHHHHHTTcccccccccccc PSIPRED cccccccccccccccccccccccccccEEEEEEEEEEccccEEEEEEEcccccccccccEEEEEEEccccccEEEEEEEccccccccEEEEEEEEEcccHHHHHHHHHcccccEEEEEEcccccEEcccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEEEccHHHHHcHHHHHHcccEEEEEccccccccccccHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHccccHHHEEEcccc //