[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69013.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->123 1ocvA PDBj 6e-07 35.5 %
:RPS:PDB   19->123 1e3rA PDBj 3e-14 23.8 %
:RPS:SCOP  19->123 1ocvA  d.17.4.3 * 7e-12 29.1 %
:HMM:SCOP  3->125 1m98A2 d.17.4.6 * 2.9e-23 31.1 %
:HMM:PFM   16->66 PF07366 * SnoaL 2.6e-09 32.0 50/126  
:BLT:SWISS 25->120 SDIS_COMTE 9e-06 35.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69013.1 GT:GENE BAC69013.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1611497..1611916 GB:FROM 1611497 GB:TO 1611916 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF02136: Nuclear transport factor 2 (NTF2) domain GB:PROTEIN_ID BAC69013.1 LENGTH 139 SQ:AASEQ MSMSRAATAEAARRFVAVWERAWAAHDVDAIVGLYAEDCVHRSMPFREPHRGRAALAEYIRWSFAAERTQDVRFSEPVVGDDGLAVAEFRVLAEEDGTPSTLAGCVFVRFDASGLAVETRDYWHTVTGHKEPTGSMFLR GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 25->120|SDIS_COMTE|9e-06|35.6|90/125| SEG 5->17|raataeaarrfva| BL:PDB:NREP 1 BL:PDB:REP 25->123|1ocvA|6e-07|35.5|93/125| RP:PDB:NREP 1 RP:PDB:REP 19->123|1e3rA|3e-14|23.8|105/126| HM:PFM:NREP 1 HM:PFM:REP 16->66|PF07366|2.6e-09|32.0|50/126|SnoaL| RP:SCP:NREP 1 RP:SCP:REP 19->123|1ocvA|7e-12|29.1|103/125|d.17.4.3| HM:SCP:REP 3->125|1m98A2|2.9e-23|31.1|122/142|d.17.4.6|1/1|NTF2-like| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 80.6 SQ:SECSTR ##################HHHHHHHTcHHHHHTTEEEEEEEEccTTcccEEcHHHHHHHHHHHHTTcccEEEEccccEEccccEEEEEEEEEEEETTEEEEEEEEEEEEEcTTccEEEEEEEccGGGccH######### DISOP:02AL 1-9| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccEEEccEEEcccccEEEEEEEEEcccccccccccEEEEEEcccccHHHHHHHHHHHccccccccccccc //