[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69015.1
DDBJ      :             putative GntR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:250 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->91 2di3B PDBj 7e-07 38.7 %
:RPS:PDB   18->248 3eetA PDBj 4e-15 17.8 %
:RPS:SCOP  18->77 1e2xA1  a.4.5.6 * 4e-15 31.7 %
:HMM:SCOP  10->109 1v4rA1 a.4.5.6 * 5e-16 33.0 %
:RPS:PFM   34->82 PF00392 * GntR 8e-08 57.4 %
:HMM:PFM   20->78 PF00392 * GntR 1.6e-19 42.4 59/64  
:BLT:SWISS 10->76 YEGW_SHIFL 1e-09 41.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69015.1 GT:GENE BAC69015.1 GT:PRODUCT putative GntR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1613379..1614131 GB:FROM 1613379 GB:TO 1614131 GB:DIRECTION + GB:PRODUCT putative GntR-family transcriptional regulator GB:NOTE PF00392: Bacterial regulatory proteins, gntR family GB:PROTEIN_ID BAC69015.1 LENGTH 250 SQ:AASEQ MSPGGADMARSTTSDHDPLYWRIAHDLLGELRDGTIPPGERLPGERHLATHFGVSRETVRQALQMLRRDGLVATDRRGSHATLPGATAEPGADAAHMPSLTFPVGAQTTEPCRATVTWEEPPAEHALALGLAPRRPTLVHRYESVAADGSGLRTALTSFSVVAVTEVAELARYRDRADGSAAAQLWRAYDWMRKAGLTLHHRDSITQFPPSVRVTRRVHDQHHRPLEITDLVADARLDALVYEFTLPAAG GT:EXON 1|1-250:0| BL:SWS:NREP 1 BL:SWS:REP 10->76|YEGW_SHIFL|1e-09|41.8|67/248| BL:PDB:NREP 1 BL:PDB:REP 30->91|2di3B|7e-07|38.7|62/230| RP:PDB:NREP 1 RP:PDB:REP 18->248|3eetA|4e-15|17.8|225/238| RP:PFM:NREP 1 RP:PFM:REP 34->82|PF00392|8e-08|57.4|47/64|GntR| HM:PFM:NREP 1 HM:PFM:REP 20->78|PF00392|1.6e-19|42.4|59/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 1 RP:SCP:REP 18->77|1e2xA1|4e-15|31.7|60/73|a.4.5.6| HM:SCP:REP 10->109|1v4rA1|5e-16|33.0|100/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 32 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ---------------11----1--11-----11111----------------11----------12111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----------------------------1-----------------------2311--1---------------------------------------------------------------------------------------1--------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 248 STR:RPRED 99.2 SQ:SECSTR HHHHHHHHHccccHHHHcHHHHHHHHHHHHHHHTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHTTcEEEcccEEEcccccEEEEccccccccccHHHHHcccTTccEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEETEEETTEEEEEEEEEHHHHTTcTTcTTccTTTTcHHHHHHTEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEETTEEEEEEEEEEEEETTTEEEEccccc## DISOP:02AL 1-20, 90-94| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHccEEEEEcccEEEEEccccHHHHHHHHccccHHHHHHHHccHHHHHHEEEEcccccHHHHHHcccccccEEEEEEEEEEcccEEEEEEEEEcHHHcccHHHHHHHHHHHHHHHcccEEEEEEEEEEEcccHHHHHHccccccEEEEEEEEEcccccEEEEEEEEEEcccEEEEEEEEEcccc //