[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69031.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:80 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->59 2dclC PDBj 2e-10 49.0 %
:RPS:PDB   5->70 2dclC PDBj 1e-15 39.4 %
:RPS:SCOP  10->70 1o51A  d.58.5.4 * 3e-15 39.3 %
:HMM:SCOP  6->57 1o51A_ d.58.5.4 * 4.9e-12 40.4 %
:RPS:PFM   4->52 PF02641 * DUF190 3e-08 55.3 %
:HMM:PFM   10->55 PF02641 * DUF190 2.8e-12 34.8 46/101  
:BLT:SWISS 1->57 Y7045_STRCO 5e-25 78.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69031.1 GT:GENE BAC69031.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1632021..1632263) GB:FROM 1632021 GB:TO 1632263 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF02641: Uncharacterized ACR, COG1993 GB:PROTEIN_ID BAC69031.1 LENGTH 80 SQ:AASEQ MTRLTGGALRVTVLIGESDTWHHKPLYTEIVHRAHAAGLAGASVFRGIEGFGGSALILDDCEVIRYAARENPGRKGEKSL GT:EXON 1|1-80:0| BL:SWS:NREP 1 BL:SWS:REP 1->57|Y7045_STRCO|5e-25|78.9|57/114| BL:PDB:NREP 1 BL:PDB:REP 9->59|2dclC|2e-10|49.0|51/97| RP:PDB:NREP 1 RP:PDB:REP 5->70|2dclC|1e-15|39.4|66/97| RP:PFM:NREP 1 RP:PFM:REP 4->52|PF02641|3e-08|55.3|47/101|DUF190| HM:PFM:NREP 1 HM:PFM:REP 10->55|PF02641|2.8e-12|34.8|46/101|DUF190| RP:SCP:NREP 1 RP:SCP:REP 10->70|1o51A|3e-15|39.3|61/89|d.58.5.4| HM:SCP:REP 6->57|1o51A_|4.9e-12|40.4|52/0|d.58.5.4|1/1|GlnB-like| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN ------------------------------------------------------------1------- ----1-------------------------------------1-------------------1---111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 82.5 SQ:SECSTR ####cccEEEEEEEEETTcEETTEEHHHHHHHHHHHHTccccEEEEccccccccccTTccEEEEEEEEEH########## DISOP:02AL 1-2, 70-80| PSIPRED ccccccccEEEEEEEcccccccccHHHHHHHHHHHHcccccHHHHHHHHccccccEEEcHHHHHHHHHHHcccccccccc //