[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69033.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:95 amino acids
:PSIPRED
:HMM:SCOP  7->93 1u2wA1 a.4.5.5 * 1.2e-05 29.2 %
:HMM:PFM   34->77 PF01978 * TrmB 0.0004 30.2 43/68  
:BLT:SWISS 7->60 YBZH_BACSU 2e-06 37.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69033.1 GT:GENE BAC69033.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1633159..1633446) GB:FROM 1633159 GB:TO 1633446 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF01726: LexA DNA binding domain GB:PROTEIN_ID BAC69033.1 LENGTH 95 SQ:AASEQ MLKLPISEKRLEILEWLKDPAAHFPPDRHGDLVEDGVTAAAVAVKLGVRRAVADTHLGLLAGIGLLRTKRIRRRTYYRRDEVRIAEVGRMFEKGW GT:EXON 1|1-95:0| BL:SWS:NREP 1 BL:SWS:REP 7->60|YBZH_BACSU|2e-06|37.0|54/100| SEG 62->79|gigllrtkrirrrtyyrr| HM:PFM:NREP 1 HM:PFM:REP 34->77|PF01978|0.0004|30.2|43/68|TrmB| HM:SCP:REP 7->93|1u2wA1|1.2e-05|29.2|72/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHccHHHHHHHHHHHccHHccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccEEEEEEcHHHHHHHHHHHHHHc //