[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69036.1
DDBJ      :             putative ABC transporter solute-binding protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  78/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:439 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->391 2z8dA PDBj 5e-36 30.5 %
:RPS:PDB   42->375 3d4cA PDBj 9e-21 14.6 %
:RPS:SCOP  42->391 1a7lA  c.94.1.1 * 8e-18 15.5 %
:HMM:SCOP  25->431 1eljA_ c.94.1.1 * 3.9e-65 28.0 %
:RPS:PFM   77->332 PF01547 * SBP_bac_1 2e-09 32.3 %
:HMM:PFM   46->335 PF01547 * SBP_bac_1 5.3e-29 22.1 271/314  
:HMM:PFM   353->420 PF09301 * DUF1970 0.001 28.4 67/117  
:BLT:SWISS 85->368 ARAN_BACHD 3e-14 21.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69036.1 GT:GENE BAC69036.1 GT:PRODUCT putative ABC transporter solute-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1637527..1638846 GB:FROM 1637527 GB:TO 1638846 GB:DIRECTION + GB:PRODUCT putative ABC transporter solute-binding protein GB:NOTE PF00497: Bacterial extracellular solute-binding proteins, family 3 GB:PROTEIN_ID BAC69036.1 LENGTH 439 SQ:AASEQ MPNTKHCRLVATALAVALGATTLAACGSSDDDSDARSGPASLTYWTWTPGMDKVVDLWNKGPGKKQQITVTVKKQASGDTLVTKILTAHKAKKAPDLVQAEYQALPTLVSNDALADISKNAGDAKGKFAEGVWQQTTLGSDAVYAIPQDIGPMMFYYREDLFKKYGLTVPTTWEQFAKTARALKHKAPDKDLTTFSSNDSGLFAGLAQQAGAKWWTTSGQKWKVGINDAASQKVADFWGGLVKEGAIDNQPMYTPAWNKALNTGKQIAWVSAVWAPGTLTSGAPDTKGKWKMAPLPQWGDSDSVTGSWGGSSTAVTTDSKHQAAAAKFATWLNTDPKALTALAKESGIYPAATTAQTSDAFQEPPAFFSNQPDFYPQAAKIAKTTAPSAWGPNVNVAYTTFKDAFAAAAKNKSDFGAALAKMQDDTVADLKKQGFEVSE GT:EXON 1|1-439:0| BL:SWS:NREP 1 BL:SWS:REP 85->368|ARAN_BACHD|3e-14|21.6|278/445| SEG 9->41|lvatalavalgattlaacgssdddsdarsgpas| SEG 64->75|kkqqitvtvkkq| SEG 201->212|glfaglaqqaga| SEG 397->410|ayttfkdafaaaak| BL:PDB:NREP 1 BL:PDB:REP 51->391|2z8dA|5e-36|30.5|331/401| RP:PDB:NREP 1 RP:PDB:REP 42->375|3d4cA|9e-21|14.6|315/470| RP:PFM:NREP 1 RP:PFM:REP 77->332|PF01547|2e-09|32.3|232/282|SBP_bac_1| HM:PFM:NREP 2 HM:PFM:REP 46->335|PF01547|5.3e-29|22.1|271/314|SBP_bac_1| HM:PFM:REP 353->420|PF09301|0.001|28.4|67/117|DUF1970| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 42->391|1a7lA|8e-18|15.5|330/380|c.94.1.1| HM:SCP:REP 25->431|1eljA_|3.9e-65|28.0|371/380|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 133 OP:NHOMOORG 80 OP:PATTERN ---------------------------1--1------------------------------------- ----6-----------------------------------1---244-354-412--1-----22-255611111455-------------------------------------------------------------11---1-------------------1--111-------------11----1-111----------------211-1-----1----11111111-----------------------------------------------------------------------------------------------1111111-1-------------------------1--------------------------------------------------------1---1111111111-----------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111---------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 390 STR:RPRED 88.8 SQ:SECSTR #########################################EEEEccTTcHHHHHHHHHHHHccEEEEEEEEEccGccTTHHHHHHHHHTTTccccEEEEcTTTHHHHHHTTccccccccHHHTHHTccHHHHHHTcccccEccEEEEEEEccEEEEETTTcccccccTTHHHHHHHHHHTTTcEEEcccccccccHHHHHHHHTTccccccEEETTEEETTccccccHHHHHHHHHHHHHHHTTcccTTccHHHHHHHHHHTTcEEEEEEcGGGHHHHHHHTcHTTccEEEEcccccTTcccccEEEEEEEEEEcTTcTTHHHHHHHHHHTTTccHHHHHHHHHHccccEEccHHHHHHHTTcHHHHHHHHHHHHcEEccccTTHHHHHHHHHHH########HHHHHTTcccHHHHHHHHHccHHHHcccccccccc DISOP:02AL 1-5, 28-38, 437-439| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccccHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHccccccccHHHHHHHHcccHHHHHHHcccccEEEEEEEEcccEEEEEEHHHHHHccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccEEEEEEcccHHHHHHHHcccccccEEEEEcccccccccEEEEEccEEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHccccccccHHHHccHHHHcccHHHcccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccc //