[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69037.1
DDBJ      :             putative ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  362/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:307 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->210 2r6gF PDBj 7e-09 25.2 %
:RPS:PDB   193->225 3dhwA PDBj 1e-07 45.5 %
:RPS:SCOP  67->271 2r6gF2  f.58.1.1 * 1e-12 22.9 %
:HMM:PFM   111->291 PF00528 * BPD_transp_1 8.8e-12 21.6 153/185  
:BLT:SWISS 58->303 YURN_BACSU 2e-15 25.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69037.1 GT:GENE BAC69037.1 GT:PRODUCT putative ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1638843..1639766 GB:FROM 1638843 GB:TO 1639766 GB:DIRECTION + GB:PRODUCT putative ABC transporter permease protein GB:NOTE PF00528: Binding-protein-dependent transport system inner membrane component GB:PROTEIN_ID BAC69037.1 LENGTH 307 SQ:AASEQ MTSARRTSYGVKGAPYAFLLPAATLFALFFALPIGYAVWLSLHKVRVFGLGLGAGARKEVWAGLENYTDALTDSALLHGALRVVGYGAIVVPVMLGLALVFALMLDTDRVRLAPFTRLAIFLPYAIPGVVAALLWGFLYLPDVSPFYYVLNGLGLPQPDLLDGGPLYLALSNIAVWGGTGFNMIVIYTSLQAIPVEVYEAAKLDGATPLQIALKIKIPMVAPSLVLTFFFSIIATLQVFSEPTTLKPLTNSVSTTWSPLMKVYQDAFGKGDIYAAAAEAAIIAVVTLVLSFGFLRAANSGNKQEEAR GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 58->303|YURN_BACSU|2e-15|25.3|241/292| TM:NTM 6 TM:REGION 23->44| TM:REGION 82->104| TM:REGION 115->137| TM:REGION 179->201| TM:REGION 216->238| TM:REGION 275->297| SEG 14->33|apyafllpaatlfalffalp| SEG 150->170|lnglglpqpdlldggplylal| SEG 272->283|iyaaaaeaaiia| BL:PDB:NREP 1 BL:PDB:REP 60->210|2r6gF|7e-09|25.2|151/490| RP:PDB:NREP 1 RP:PDB:REP 193->225|3dhwA|1e-07|45.5|33/203| HM:PFM:NREP 1 HM:PFM:REP 111->291|PF00528|8.8e-12|21.6|153/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 67->271|2r6gF2|1e-12|22.9|205/244|f.58.1.1| OP:NHOMO 947 OP:NHOMOORG 376 OP:PATTERN ----------------1--111--1112--1------------------------11----111---- ----F--1--1----11-----2211-----1-----1--2--16LH1667-966--2--31-26129A912233555----3-----------------------------------------------------23333---2111-3-----11-1--1-----333--1-----1----76---24-32-11111122--11111B322--112--1-1124334335O--------------------12--22---------22-----2-1--1--------11111111111--------------11---111132-22-------1-122---1-18--11--3--11----9---2347--1-------1111---743---21-1112221222226---------37--GCC5FD8KIK77-----2213333331--------1--2--11---------------------------------1--1112------1-11111121111111-111-1--1111--11-12121-------2--------------------------------------11-1---------------------------------2-------1----------------------1---------1243-111111111111-111111121111-11111132344--111111111111111111-111111--244444444444---------11111-214---------------------------11111-1-11-12-1-1-------------------1-111--111111111111-------------------11-------------------------1556339453--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 57.7 SQ:SECSTR ###########################################################cccTTTTTcGGGTcTTTcTTHHHHHHHHHHHHHHHHHHHHHHHHHHTccccTTHHHHHHHTTHHHHccHHHHHHHHHHHTcccccHHHHHHHHTccccccTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHGGGccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHH####################################################################### DISOP:02AL 1-10, 298-307| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEcHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //