[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69040.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->113 1bylA PDBj 3e-12 13.4 %
:RPS:SCOP  1->113 1bylA  d.32.1.2 * 1e-12 13.4 %
:HMM:SCOP  1->115 1q0oA2 d.32.1.3 * 4.6e-18 33.6 %
:BLT:SWISS 67->116 LGUL_VIBPA 7e-04 44.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69040.1 GT:GENE BAC69040.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1641935..1642291 GB:FROM 1641935 GB:TO 1642291 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC69040.1 LENGTH 118 SQ:AASEQ MTAGLKTIIYPVKDLARAKALFGALLGVEPYADEPYYVGFKDAGQDVGLDPNGHAKGMTGPVPYWHVTDIRSRLSALLNAGAEPLQDVQDVGGGRLIAFVKDADGNLIGLIQEPAAHQ GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 67->116|LGUL_VIBPA|7e-04|44.0|50/138| RP:PDB:NREP 1 RP:PDB:REP 1->113|1bylA|3e-12|13.4|112/122| RP:SCP:NREP 1 RP:SCP:REP 1->113|1bylA|1e-12|13.4|112/122|d.32.1.2| HM:SCP:REP 1->115|1q0oA2|4.6e-18|33.6|113/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 10 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------------21-----1---------------------1-----------------------------------1-11--------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 99.2 SQ:SECSTR ccccccccEEEEccHHHHHHHHHHTTccEEEEEcccEEEEEETTEEEEEcTTTGGGcEEEEEEccHHHHHTTcccccccccccEEcccEEETTEEEEEEEEcTTccEEEEEEccTTc# DISOP:02AL 1-2, 54-57, 115-118| PSIPRED cccccEEEEEEcccHHHHHHHHHHHHccccccccccEEEEcccEEEEEEEEccccccccccEEEEEcccHHHHHHHHHHcccHHccccccccccEEEEEEEcccccEEEEEccccccc //