[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69042.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  483/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.153.2d.58.32
:342 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->111 2uuvD PDBj 1e-07 29.4 %
:RPS:PDB   2->340 3d2hA PDBj 6e-27 12.6 %
:RPS:SCOP  2->152 1kuuA  d.153.2.1 * 5e-16 17.5 %
:RPS:SCOP  132->340 1f0xA1  d.58.32.2 * 3e-16 13.5 %
:HMM:SCOP  2->109 1f0xA2 d.145.1.1 * 1.9e-38 58.9 %
:HMM:SCOP  112->342 1e8gA1 d.58.32.1 * 1.3e-56 40.5 %
:RPS:PFM   1->65 PF01565 * FAD_binding_4 4e-08 49.2 %
:RPS:PFM   224->340 PF02913 * FAD-oxidase_C 1e-19 49.6 %
:HMM:PFM   109->340 PF02913 * FAD-oxidase_C 3.8e-58 37.5 232/249  
:HMM:PFM   2->71 PF01565 * FAD_binding_4 4.5e-20 50.0 70/138  
:BLT:SWISS 1->340 GLCD_BACSU 2e-48 39.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69042.1 GT:GENE BAC69042.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1642815..1643843 GB:FROM 1642815 GB:TO 1643843 GB:DIRECTION + GB:PRODUCT putative oxidoreductase GB:NOTE PF02913: FAD linked oxidases, C-terminal domain GB:PROTEIN_ID BAC69042.1 LENGTH 342 SQ:AASEQ MEPGVITAVLDRAAGAHGLRYAPDPASAALSTIGGNIATNAGGLRCAKYGVTRDSVLGLEAVLADGTVVGTGRRTVKGVTGYDLTALLTGSEGTLAVITSATVRLRPVPVATATLAAFFDSFEAAAEASYAIGRAGIEPALAELVDGPVLHAIDPALRERGAALLLVQCDGAGAAAEAEVVARVLAPSATAVETTTDPVEAESLLAARRLALPALERLGRPLIEDIAVPRSRLAEAVREIRAISARHDVPVFTIAHAADGNLHPIIVVDRSLPGLPDAAWEAAGEIFALALRLGGTLTGEHGVGVLKRQWVADELGPAAHALQRRIKRAFDPRGVLNPGKCL GT:EXON 1|1-342:0| BL:SWS:NREP 1 BL:SWS:REP 1->340|GLCD_BACSU|2e-48|39.4|340/470| SEG 66->81|gtvvgtgrrtvkgvtg| SEG 116->131|aaffdsfeaaaeasya| SEG 171->182|gagaaaeaevva| SEG 204->222|llaarrlalpalerlgrpl| SEG 288->299|alalrlggtltg| BL:PDB:NREP 1 BL:PDB:REP 1->111|2uuvD|1e-07|29.4|102/528| RP:PDB:NREP 1 RP:PDB:REP 2->340|3d2hA|6e-27|12.6|334/498| RP:PFM:NREP 2 RP:PFM:REP 1->65|PF01565|4e-08|49.2|65/139|FAD_binding_4| RP:PFM:REP 224->340|PF02913|1e-19|49.6|117/242|FAD-oxidase_C| HM:PFM:NREP 2 HM:PFM:REP 109->340|PF02913|3.8e-58|37.5|232/249|FAD-oxidase_C| HM:PFM:REP 2->71|PF01565|4.5e-20|50.0|70/138|FAD_binding_4| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01565|IPR006094| GO:PFM GO:0050660|"GO:FAD binding"|PF01565|IPR006094| GO:PFM GO:0003824|"GO:catalytic activity"|PF02913|IPR004113| GO:PFM GO:0050660|"GO:FAD binding"|PF02913|IPR004113| RP:SCP:NREP 2 RP:SCP:REP 2->152|1kuuA|5e-16|17.5|137/202|d.153.2.1| RP:SCP:REP 132->340|1f0xA1|3e-16|13.5|193/237|d.58.32.2| HM:SCP:REP 2->109|1f0xA2|1.9e-38|58.9|107/0|d.145.1.1|1/1|FAD-binding domain| HM:SCP:REP 112->342|1e8gA1|1.3e-56|40.5|227/0|d.58.32.1|1/1|FAD-linked oxidases, C-terminal domain| OP:NHOMO 1524 OP:NHOMOORG 686 OP:PATTERN 11---13212222212-1222212-------1----------------12111--------2111--- --124-------1-22222-22223532333222221793-32211-2-111131-11--1121344321---------1-1311111--------------1---------------------------------45533----12212221221111111121222222-1-----1----22233--121122222222222222253111122234313--------2------------------------1111----11--21------------------------------------------------------2-121111111212-122111121-1-1--2-231121--22--1--1-221211411111238432244453433333333334-23432635243-4332336433655411143344442342222222232221224-----------------------------1126-1433355445453333344463333226447665-122254433634335223211-22111111122233312512223342443-212112222433423131--1111111111111111111111221---2----------------------------3312-------------1--1111111--111111111-1111111--1---------------------------------------------------------2-322----------------------1111-22221221122131122------------------------11111111111111111-111111----------1--------------------------11---1---311 ----222-42--24224422433535322222222222221221222233356623143444233243341122311-112444531--3424231111-12-231-22-521131111--12154-427F4-324-1--21121-212121-1111-422132221314213222121G1111131-62311-54522 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 342 STR:RPRED 100.0 SQ:SECSTR EETTccHHHHHHHHHHHcccEEccccccTTccHHHHHHTccccTTHHHHccGGGGEEEEEEEcTTccEEEccEEcHHHHcHHHHHHHTTccTTcccEEEEEEEEcEEccccEEEEEEEEEEcHHHHHHHHHHHHHHHHHccTTEEEEEEEEEETTEEEEEEEEcccHHHHHHHHHHHcGGGcccGGGcHHHHHHHHTTcccGGGGGcTTccccccEEEEEEEEccccccHHHHHHHHHHHHHcTTEEEEEEEccccccTTccEEEEEEEEEcGGGGGGcccccccGGGccGGGccccTTcHHHHHTHHHHHHHHHHGGGHHHHHHHHHHHcTTcccccTTcc DISOP:02AL 342-343| PSIPRED ccccccHHHHHHHHHHcccEEEEccccccccHHHHHHHcccccccccccccHHHEEEEEEEEcccccEEEEccccccccccccHHHHHHcccccEEEEEEEEEEEEEccccEEEEEEEEccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccccccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccc //