[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69043.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:139 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->24 PF03752 * ALF 0.00034 29.4 17/43  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69043.1 GT:GENE BAC69043.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1644029..1644448) GB:FROM 1644029 GB:TO 1644448 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69043.1 LENGTH 139 SQ:AASEQ MDTPSNDRPTPETAAAAQEALTALSVHTMDTEALDTLADSEVLVPVPDDAAEPDASDPSIVALPVLEESGGEQTVPVFTSEPAMAELLPFVSRYRVVPLGALASQWPSAGLSLAIDAGSPHGLTLDSDGVRTLLARPSA GT:EXON 1|1-139:0| SEG 12->24|etaaaaqealtal| SEG 44->59|vpvpddaaepdasdps| HM:PFM:NREP 1 HM:PFM:REP 8->24|PF03752|0.00034|29.4|17/43|ALF| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------11-----------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 138-139| PSIPRED ccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHccccEEEEccccccccccccccEEEEEEEEcccccEEEEEEEccHHHHHHHHHHHHEEEcccHHHHHcccccccEEEEEccccccEEEEcccHHHHHccccc //