[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69045.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   75->115 PF00583 * Acetyltransf_1 0.00026 22.0 41/83  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69045.1 GT:GENE BAC69045.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1646423..1646920) GB:FROM 1646423 GB:TO 1646920 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00583: Acetyltransferase (GNAT) family GB:PROTEIN_ID BAC69045.1 LENGTH 165 SQ:AASEQ MQGNQTSVMTAVHGRLPGSRAGASPRRAEGRHRRSGRRGGRWHRRLLAYRDVELVQCPAPDGRGEDCLLLVHIRKVVGRVTYQACDECAEGVITDVVLDGPFRDSGLGTRALLHLRSRHPGVTWRTTLDHRLTRGLLRRMRIPRTVVDGSCSHVRAAVVAQAAGG GT:EXON 1|1-165:0| SEG 26->45|rraegrhrrsgrrggrwhrr| SEG 154->163|vraavvaqaa| HM:PFM:NREP 1 HM:PFM:REP 75->115|PF00583|0.00026|22.0|41/83|Acetyltransf_1| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-9, 18-39, 164-165| PSIPRED cccccccccHHHHccccccccccccccccccHHHHHcccHHHHHHHHHHHcEEEEEcccccccccEEEEHHHHHHHHHHccHHHHHHHHHHHHHHEEEccccccccHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHccccccccccHHHHHHHcccccccc //