[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69055.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:580 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->555 PF12077 * DUF3556 e-169 55.9 %
:HMM:PFM   1->560 PF12077 * DUF3556 6.2e-276 60.7 560/574  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69055.1 GT:GENE BAC69055.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1657983..1659725) GB:FROM 1657983 GB:TO 1659725 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAC69055.1 LENGTH 580 SQ:AASEQ MGFLAPNMADVDIRQWRTRPYQQRIRPLAEHWAGHGFGTPGIVHLLYLVKITAYALGGIAVVSLTPGVGGIAHFGSWWAEPLVYQKLVVWTLLYEVLGLGCGSGPLSSHFLPPVGAFLHWLRPGTVRLPPWPDRIPFTSGTRRTAADVTLYAAVLGAAGWLLCAPGGPGAAGVAAPWRVAVLAAALALLGLRDKTVFLAARAEHYGLTLLVFLFPAADMTAALKLIMLALWWGAATSKLNRHFPFVVAVMISNSPLRPAWLKRRLYRHYPDDLRPSGLAAAAAHGGTVIEYVVPLVLVLSHGGTVTTVALAVMVVFHLHIMSTFPMGVPLEWNVFFIYSALVLFGHDAAVGAFALHSPALAAVLVLSLVMVPVLGHVRPDLVSFLPSMRYYAGNWATGLWCFRKGTEHRLNEHIVKASGLPVDQLTRLYGADTAELVLHQGLAWRAMHSHGRALVGLLPRAVDDVESYDVREGEMVAGAVLGWNFGDGHLHNEQLVAAVQQRCGFAPGELRVVLLESQPTHRSRQHYRIVDAASGLIEEGYVNVRDMVVRQPWLDDDTPAIPVEPIEAPRPVTEAAAAHE GT:EXON 1|1-580:0| TM:NTM 9 TM:REGION 46->68| TM:REGION 82->104| TM:REGION 144->166| TM:REGION 170->191| TM:REGION 207->229| TM:REGION 276->298| TM:REGION 305->327| TM:REGION 333->355| TM:REGION 357->379| SEG 97->108|lglgcgsgplss| SEG 155->191|lgaagwllcapggpgaagvaapwrvavlaaalallgl| SEG 304->315|tvttvalavmvv| SEG 354->374|alhspalaavlvlslvmvpvl| RP:PFM:NREP 1 RP:PFM:REP 1->555|PF12077|e-169|55.9|555/571|DUF3556| HM:PFM:NREP 1 HM:PFM:REP 1->560|PF12077|6.2e-276|60.7|560/574|DUF3556| OP:NHOMO 45 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- --------------13322-21--4122222311111121-------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 574-580| PSIPRED ccccccccccccHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHEEEEEccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccHHHHHHHHHHccccHHccHHHHHHHHHHHHHHHHHEEccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHEEEEEccccHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccEEEEEEcccccccccEEEEEEEEEccEEEEEEEEHHHHHHHcccccccccccccccccccccHHHHHcccc //