[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69056.1
DDBJ      :             putative acyl-CoA synthetase
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  807/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
e.23.1
:485 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   136->475 2d1sA PDBj 2e-42 34.8 %
:RPS:PDB   52->475 3cw9A PDBj 4e-66 25.8 %
:RPS:SCOP  52->475 1md9A  e.23.1.1 * 5e-70 29.7 %
:HMM:SCOP  2->481 1pg4A_ e.23.1.1 * 9.3e-167 42.0 %
:RPS:PFM   52->402 PF00501 * AMP-binding 8e-55 44.6 %
:HMM:PFM   32->409 PF00501 * AMP-binding 9e-119 38.2 377/418  
:BLT:SWISS 52->475 LCFB_BACSU 2e-76 37.8 %
:PROS 139->150|PS00455|AMP_BINDING
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69056.1 GT:GENE BAC69056.1 GT:PRODUCT putative acyl-CoA synthetase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1659744..1661201) GB:FROM 1659744 GB:TO 1661201 GB:DIRECTION - GB:PRODUCT putative acyl-CoA synthetase GB:NOTE PF00501: AMP-binding enzyme GB:PROTEIN_ID BAC69056.1 LENGTH 485 SQ:AASEQ MHSAELPDLRARQDADGACIADDAADLDNAAFARRVRRAASALRARGVGRGDVVALLLPNTADFVVALFAAWRLGAAVTPVNPALTESEVRYQLGDAGAAVAVTAGPSPLAGALPVAELSTGPEDTTAPETDAGALALLIYTSGSTGRPKGVMLDHANLAAMAEMMTGTARLTETDHSLLILPLFHVNGIVVGVLSPLLAGGRVTVAGRFRAETFFDLVATVRPTCFSAVPAIYSMLAELPDHVRPDTSSVRFAACGAAPMPAALIERFERRYDIPVLEGYGLSEGTCASTTNPLYGRRKPGTVGLPLPGQQVAVMDPQGRIAPAGATGEVVVRGPNVMRGYLGRPEETARTVIDGWLHTGDVGRFDEDGYLVLVDRIKDLIIRGGENIYPKEIETVLGDHPEVLEAAVVGAAEPRLGEVPVAFVALRPGASATTADLLDHCRARLAEFKVPTGITLVGRLPRNPVGKTDKPALRSGTTALTTAG GT:EXON 1|1-485:0| BL:SWS:NREP 1 BL:SWS:REP 52->475|LCFB_BACSU|2e-76|37.8|423/513| PROS 139->150|PS00455|AMP_BINDING|PDOC00427| SEG 14->51|dadgaciaddaadldnaafarrvrraasalrargvgrg| SEG 97->106|agaavavtag| SEG 254->264|aacgaapmpaa| SEG 403->414|evleaavvgaae| BL:PDB:NREP 1 BL:PDB:REP 136->475|2d1sA|2e-42|34.8|330/538| RP:PDB:NREP 1 RP:PDB:REP 52->475|3cw9A|4e-66|25.8|423/503| RP:PFM:NREP 1 RP:PFM:REP 52->402|PF00501|8e-55|44.6|350/405|AMP-binding| HM:PFM:NREP 1 HM:PFM:REP 32->409|PF00501|9e-119|38.2|377/418|AMP-binding| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00501|IPR000873| GO:PFM GO:0008152|"GO:metabolic process"|PF00501|IPR000873| RP:SCP:NREP 1 RP:SCP:REP 52->475|1md9A|5e-70|29.7|421/536|e.23.1.1| HM:SCP:REP 2->481|1pg4A_|9.3e-167|42.0|479/643|e.23.1.1|1/1|Acetyl-CoA synthetase-like| OP:NHOMO 11787 OP:NHOMOORG 1054 OP:PATTERN 55-2--8GHGHIHFEB1164642KA444216A322---222217576954433----1---243---2 58C6g774555E6Dk*qaa-ZmDD*xaaaaaYxs*tj***2hIh43263A71E7G89D11UNN3jNoaShB4343444-496G124328856-6221--426112G123311111111111111143445424454DDDEF332c8AAE7FFE22332224125337LBX711222223122285599--3E9QDDEDEHCICEDFGJC88EEFJDEIBJDEC46333233U4344545555544455543451-2-22-2---122211121233121111213112111111111111111111111111111111111121---51111511111L-77------71-93271CA4262--B31111-21817OEEK11-1177fTh636aTaTP34443343445-HGJHGNDDAIM-AAAD8A9A8DB9GN9E8DCJ7B99CBJ22222222B3115ED9----------111111111111111----3GIhG-7MLCJJQSTTUSMNNGIGKTeeecDYXHfYlpb36IIGBDDHEXEMPZU32F2-33B52222222658IBC4pMH86885A7666-9A85A4658BCCAhO9922211111211-2--------222622BC37B58576786666BC98886A6986BA--14B83------B6LB764888C8CC887-7898778889889887886657AAOM5756677777776766785667776--566666555565---52334256544AR2A3332321222231127798749899H4NRLPSOLKCFDGHBFDO4444454542444C8A99A7637856645444442222--327733552222222241------------------------------------281 -212DI8-B65-99KVYUKeRXWgfasMKKOIMUTOQOKOKNOJGJIGMXSUWZNLNNJIIIF4554345544354334354459534-HNDYKFD6456A6HQQN3FICjGbIVHQB6577J8gO7K9r*P2QKZC889M9EHJ7EB72LB4V7JDDSIKYJZJWDOFXOJMVH46B8w98AF8UXb*OjbBAOKLHO ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 434 STR:RPRED 89.5 SQ:SECSTR ###################################################cEEEEEccccHHHHHHHHHHHHHTcEEEEEcTTccHHHHHHHHHHTTccEEEEcccHHHHHHHHHTTcccEccccccccccTTcEEEEEEEcccccccEEEEEEGGGHHHHHHHHHHTccccTTcEEEEcccTTcHHHHHTTHHHHHHTTcEEEEcccccHHHHHHHHHHHTccEEEEcHHHHHHHHHHHHHTTcccTTccEEEEccccccHHHHHHHHHHcccEEEEEEEETTTEEEEEEEccTccccEEcccTTccEEEEcTTccTTccccTTccEEEEEccTTcccccTTcHHHHHHHEETTEEEEEEEEEEcTTccEEEEEEccccEEETTEEEcHHHHHHHHTTcTTEEEEEEEEEEETTTEEEEEEEEEEcTTccccHHHHHHHHHccccGGGcccEEEEcccccccTTccccHHHHHTTccEEEEEc DISOP:02AL 481-485| PSIPRED ccHHHHHHHHHHHccccEEEEccccEEcHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHccccEEEEEcccccccccccHHHHccccccccccccccccEEEEEEccccccccccEEEcHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHccccEEEccHHHHHHHHHcccccccccccEEEEEEccccccHHHHHHHHHHcccEEEEcccccccccEEEEcccccHHccccccccccccEEEEEcccccccccccEEEEEEcccHHHHHHcccHHHHHHHHHcccEEEccEEEEccccEEEEEEcEEEEEEEccEEEcHHHHHHHHHHcccEEEEEEEcccccccccEEEEEEEEcccccccHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHccHHHHHHHccc //