[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69061.1
DDBJ      :             putative fatty acid-CoA racemase
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  366/915 : Eukaryota  148/199 : Viruses  0/175   --->[See Alignment]
c.123.1
:389 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->385 1q6yA PDBj 6e-29 28.0 %
:RPS:PDB   83->193 2c9eA PDBj 2e-25 13.5 %
:RPS:SCOP  11->385 1xa3A  c.123.1.1 * 3e-74 23.6 %
:HMM:SCOP  9->385 1q7eA_ c.123.1.1 * 2.8e-101 38.0 %
:RPS:PFM   76->229 PF02515 * CoA_transf_3 3e-22 40.9 %
:HMM:PFM   76->263 PF02515 * CoA_transf_3 2e-48 31.0 187/191  
:BLT:SWISS 10->382 FCTA_STRAW 2e-37 31.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69061.1 GT:GENE BAC69061.1 GT:PRODUCT putative fatty acid-CoA racemase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1665388..1666557) GB:FROM 1665388 GB:TO 1666557 GB:DIRECTION - GB:PRODUCT putative fatty acid-CoA racemase GB:NOTE PF02515: CoA-transferase family III GB:PROTEIN_ID BAC69061.1 LENGTH 389 SQ:AASEQ MMDSTTAGDTGPLNGVRVIDLSTVVMGPYAAQILGDLGADVIKIESPSDTVRVGPYRTTPGMTPLNLNVNRNKRSVSLNLKDDADRARALELIDSADVLVTNMRPGALARLGLAHADVAARNPGLVYAHAQGFRSDSDRAGNAAYDETVQAASGLVDVANRALGTPAYLPTIIGDKVCALTIVYTVLAALVHRGPTGAGQYIEIPMTDTLIAFNLVEHLAGHVFEPPEGPTGFPLSMKRGHRAVPTRDGLACVIPYNPQNFRDFFLAADRADLAADPRVNGEAVADDDVDALMELVGECSPSMTTEEWARVCAKHSIPMAPVLELERAAEDPYVRGGRLLDVVDHPSEGAIRTVGIPVRFSATPGSVRRLAPLPGQHTEEVFGELATGR GT:EXON 1|1-389:0| BL:SWS:NREP 1 BL:SWS:REP 10->382|FCTA_STRAW|2e-37|31.1|370/409| SEG 261->276|frdfflaadradlaad| BL:PDB:NREP 1 BL:PDB:REP 12->385|1q6yA|6e-29|28.0|372/417| RP:PDB:NREP 1 RP:PDB:REP 83->193|2c9eA|2e-25|13.5|111/317| RP:PFM:NREP 1 RP:PFM:REP 76->229|PF02515|3e-22|40.9|154/189|CoA_transf_3| HM:PFM:NREP 1 HM:PFM:REP 76->263|PF02515|2e-48|31.0|187/191|CoA_transf_3| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02515|IPR003673| GO:PFM GO:0008152|"GO:metabolic process"|PF02515|IPR003673| RP:SCP:NREP 1 RP:SCP:REP 11->385|1xa3A|3e-74|23.6|364/400|c.123.1.1| HM:SCP:REP 9->385|1q7eA_|2.8e-101|38.0|376/417|c.123.1.1|1/1|CoA-transferase family III (CaiB/BaiF)| OP:NHOMO 2537 OP:NHOMOORG 536 OP:PATTERN --1----232523322-1-211-51--12-32-----------------------------1-2---- --2351-1---1-16TH44-4G--CS444447FDIE5HRk-M3W1--2----442224--12B122C6635-111----1616------------------2------12--------------------------55575---22----------------------------------------22---11----------------1--------22323--------1----------------------2------2-1--11--------------------------------------------------------12--2222222-2--3-------1---1----87-1----1--------2--6339-----2-KBC--7B59A533442443442-34A33E39855-41111222133296472659222426722222222511--723------------------------------47F6-5taHfEDDFIF5567799GE887858U7TRclc2678574798N8I9PS455----21-------1--722-121------------2--3----111111-5---------------------------1---1-4-3--1------1----1-11-1--------------1-2-3--3333333333-2333333333233223221------111111111111111111122333321----------------------1111-2212---------------44324242222155553656342455213------------------------------------------111111------------------------------------------------- ----111-----1126564655378673322222225655566333334758C9667124333-1---------1------111-1---4545435311-212432-2-23251221-1112222325-AU3-633212131222211212115-532623112222232A1222-1------11---73---1-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 376 STR:RPRED 96.7 SQ:SECSTR #########ccTTTTcEEEEEccTTHHHHHHHHHHHTTcEEEEEEcTTcGGGGTcccccTTcccHHHHTcTTcEEEEccTTccHHHHHHHHHHHHHHHHHTTccTTcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHTTcTTccccHHHHHHHHHHHHHHHHTccHHHHHHHHHccccEEEEEHHHHHHHHTHHHHHHcccTTcTTTTTcccccccccTTTTTTcTTcEEEEEccGGGHHHHHHHHTcGGGGTcTTTccHHHHGGGHHHHHHHHHHHHTTccHHHHHHHHGGGTccEEEcccHHHHHHcHHHHHHTcEEEEEETTTEEEEEEcccccccccccccccccccTTTTHHHHHHHT#### DISOP:02AL 1-11| PSIPRED ccccccccccccccccEEEHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccEEEEcccHHHHHHHcccHHHHHHHcccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEccccEEEEEEcccHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccEEEcccHHHHHccHHHHHccEEEEEEcccccEEEEccccccccccccccccccccccccHHHHHHHHcccc //