[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69062.1
DDBJ      :             putative LysR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  577/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->247 3fzvC PDBj 2e-11 29.0 %
:RPS:PDB   1->105 1b9nA PDBj 4e-20 16.3 %
:RPS:SCOP  1->101 1b9mA1  a.4.5.8 * 1e-18 17.8 %
:RPS:SCOP  127->279 1i69A  c.94.1.1 * 1e-11 18.2 %
:HMM:SCOP  1->89 1ixcA1 a.4.5.37 * 1.8e-23 40.4 %
:HMM:SCOP  92->299 1ixcA2 c.94.1.1 * 5e-15 24.4 %
:RPS:PFM   6->61 PF00126 * HTH_1 2e-08 51.8 %
:HMM:PFM   5->61 PF00126 * HTH_1 1e-25 49.1 57/60  
:HMM:PFM   127->280 PF03466 * LysR_substrate 8.5e-21 26.8 149/209  
:BLT:SWISS 1->255 ALSR_BACSU 2e-22 29.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69062.1 GT:GENE BAC69062.1 GT:PRODUCT putative LysR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1666726..1667637) GB:FROM 1666726 GB:TO 1667637 GB:DIRECTION - GB:PRODUCT putative LysR-family transcriptional regulator GB:NOTE PF00126: Bacterial regulatory helix-turn-helix protein, lysR family GB:PROTEIN_ID BAC69062.1 LENGTH 303 SQ:AASEQ MDMLHLRYFVAVAEELNFSQAARKLHMAASPLSQRIKDLERELGYELFERTTHRVDLTPAGSALLPMARDILERVNAIPWRLSEAVRPRLDRLFIGMPAGVHPLLRERVRLLEDACREVCELKRWPGTSADLADAVHDGRLAMALVRLPVSDPALEIIEVMRERLGAAVPADRFAGRASVTLDELADLSYVATPNDATPAYFEEIDAHLNSVGVKKRIRINMADYSGSSELISSGMAFSMTMLSPESPMHLYRLDNVVVLPVEDFQPALVTGLLFRRDRADDGGDLSDVAARARQIFHEVISV GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 1->255|ALSR_BACSU|2e-22|29.1|247/302| BL:PDB:NREP 1 BL:PDB:REP 6->247|3fzvC|2e-11|29.0|221/279| RP:PDB:NREP 1 RP:PDB:REP 1->105|1b9nA|4e-20|16.3|104/258| RP:PFM:NREP 1 RP:PFM:REP 6->61|PF00126|2e-08|51.8|56/60|HTH_1| HM:PFM:NREP 2 HM:PFM:REP 5->61|PF00126|1e-25|49.1|57/60|HTH_1| HM:PFM:REP 127->280|PF03466|8.5e-21|26.8|149/209|LysR_substrate| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->101|1b9mA1|1e-18|17.8|101/122|a.4.5.8| RP:SCP:REP 127->279|1i69A|1e-11|18.2|143/206|c.94.1.1| HM:SCP:REP 1->89|1ixcA1|1.8e-23|40.4|89/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 92->299|1ixcA2|5e-15|24.4|201/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3040 OP:NHOMOORG 582 OP:PATTERN -------------------------------------------------------------------- 363-C1-33332-1A33----411-E------55558CGH-93732-1-1--1322-4--224-85GCC811222----12851-------1-1-------5--12--11--------------------------13311---3-1-12--1-1-----------6322-------------112-----5164444422423232431-76762251332121122211CF111-1111-111111222-4-222112-2122211--122--11--1--------------------111111111-1111--------2-1-641111111-1--2------1----311-167---1113-1-----2--12111-1--1358791-52621344544454455-43334946973-D5531148B7679B1--34C12243563233333353351321------------------------------147119SLEYPOOQNSCCCCBIIQQEEEE9BUCWIORL-1C89667A5P9E5N33522211741122212-11355-111-12--26224-1--212-2-322346-1---------------------1---338331241112123333-312---4-23-11---2315------A45647AA887A76799-889A966989879789987CHC595468798B9BAAAB9A98AF56466652-544455435555---21111112111586A333213111111--1A988A58231G2EFJEDLGL5GHHF49791--------21222555552326666586883333222--1------------------------------------------------------5- -------------2------------------------------------------------------------------------------------------------------------------------------------------------3----1------------------------6-----3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 269 STR:RPRED 88.8 SQ:SECSTR EcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccTTcHHHHHHHHTcccTHHHEHHHHHcccccccTTccccTTHHHHTcccEEHHHHcccccEEEEEEEccGGGccccTHHHHHHHTccTTcEEEEccccEEEETTEEEEccHHHHHHcEEEEGGGcTTccTTcEEEEEEcGGGcEEEccccEEEcccccc#cccTTEEEEEcccTTcEEEEEE################################# DISOP:02AL 84-87| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEEcccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHcccEEEEEEEccccccccEEEEEEcccEEEEEccccccccccccHHHHccccEEEEccccccHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHccccHHHHHHHHHHHHHHHccccEEEEEcccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcc //