[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69065.1
DDBJ      :             putative hydrolase
Swiss-Prot:             

Homologs  Archaea  41/68 : Bacteria  596/915 : Eukaryota  184/199 : Viruses  0/175   --->[See Alignment]
d.160.1
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   64->250 2w1vA PDBj 6e-25 37.0 %
:RPS:PDB   28->262 2e2kB PDBj 2e-41 24.0 %
:RPS:SCOP  28->252 1f89A  d.160.1.1 * 5e-42 32.1 %
:HMM:SCOP  1->261 1f89A_ d.160.1.1 * 8.1e-59 38.4 %
:RPS:PFM   40->176 PF00795 * CN_hydrolase 2e-14 47.7 %
:HMM:PFM   8->176 PF00795 * CN_hydrolase 2.8e-27 31.7 167/184  
:BLT:SWISS 36->252 AMIF_PSESM 4e-26 34.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69065.1 GT:GENE BAC69065.1 GT:PRODUCT putative hydrolase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1671135..1672004) GB:FROM 1671135 GB:TO 1672004 GB:DIRECTION - GB:PRODUCT putative hydrolase GB:NOTE PF00795: Carbon-nitrogen hydrolase GB:PROTEIN_ID BAC69065.1 LENGTH 289 SQ:AASEQ MSRPLPLALAQLPPRPAHAPLSGFAAEAESILARFPHTRMAVFPELHLCGVDALGAEAHEQLREIAEPLDGPRVKELAELAGDLGVWLLPGSVCERGPAGELFNTALAFSPQGRLAAWYRKVFPWRPSEPYDPGDRFVVFDVPEAGRIGFAICYDAWFPEVARHLAWRGAEVIVNPVMTTTSDRAQEVVLARANAIVNQVHVVSVNTAGPLGSGHSLVVDPEGRIRAEAPGDGTAILTDVIDLDDVTRVRTHGTAGVNRMWDQFTDTDAPIELPLYGGRIDPRTWRPGA GT:EXON 1|1-289:0| BL:SWS:NREP 1 BL:SWS:REP 36->252|AMIF_PSESM|4e-26|34.8|210/338| SEG 4->21|plplalaqlpprpahapl| BL:PDB:NREP 1 BL:PDB:REP 64->250|2w1vA|6e-25|37.0|184/274| RP:PDB:NREP 1 RP:PDB:REP 28->262|2e2kB|2e-41|24.0|229/314| RP:PFM:NREP 1 RP:PFM:REP 40->176|PF00795|2e-14|47.7|130/171|CN_hydrolase| HM:PFM:NREP 1 HM:PFM:REP 8->176|PF00795|2.8e-27|31.7|167/184|CN_hydrolase| GO:PFM:NREP 2 GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00795|IPR003010| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF00795|IPR003010| RP:SCP:NREP 1 RP:SCP:REP 28->252|1f89A|5e-42|32.1|221/271|d.160.1.1| HM:SCP:REP 1->261|1f89A_|8.1e-59|38.4|255/281|d.160.1.1|1/1|Carbon-nitrogen hydrolase| OP:NHOMO 1471 OP:NHOMOORG 821 OP:PATTERN 111--3---------1111111111--1--11111--------21-2211212-111111-1111-11 113-4111111--1411----1111A-----1311134A7141321-1111-414112--112-2115341---------111--22222211211-----2-1-21121---------------2112211215311121---124111221112211211211221221111111111111121-----22-22222212122222211111-22113111--11111132111111111111111-1111-------1-1-111111-1-11------------11---------------------------111-----32-11111111-1-1211----------111111331111-----11--1-22222-----114541114112111111111112-34231133312-1333112342224123312243442111111111131113121------------------------------33321122111333622223222222222214321122-11111211121212311112111211111111111111313121--1-111-22222223211111421-1112111111413333343-1111221231331133111111-1111111121122---2224------1-331-1---------------------------------222211-1-1-11-111-1-11-------2-222222222222--11-----222233343---------------111111211121544444452565423231---------1111111111312211111111111111--1-111111--------------------------------------211-----121 ----322-211-111332223333331111111111211112222222451232221-2221221111112111111-1111111122-111311111-1212211-26-41523222211122521527B2-5372211222231222-21131111321212221257-11511332Y1124323343635221118 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 91.0 SQ:SECSTR ########################HHHHHHHHHHcTTEEEEEccTTTTTccccGccTTTTTcGGGccccccHHHHHHHHHHHHHTcEEEEEEEEccccTTccEEEEEEEcTTccEEEEEEcccccTTTccccccccccEEcGGGGcEEEEEEGGGGGcHHHHHHHHHTTccEEEEEEccccccHHHHHHHHHHHHHHHTcEEEEEEccccccccccEEEcTTccEEEEccccccEEEEEEEcHHHHHHHHHHccTTcHHHHTccccccccccccccTTTTccccTTH## DISOP:02AL 288-289| PSIPRED ccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEccHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEEccEEEEcccccEEEEEEEEcccccEEEEEccccccccccccccccccEEEEEccccEEEEEEEcHHccHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEcccccEEEcccccccEEEEEEEcHHHHHHHHHHccHHHHcccccccccccHHHHHHcccccccccccccc //