[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69066.1
DDBJ      :             putative GntR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  113/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.78.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->231 2di3B PDBj 1e-06 27.3 %
:RPS:PDB   4->249 3c7jA PDBj 2e-19 18.5 %
:RPS:SCOP  27->94 1e2xA1  a.4.5.6 * 1e-10 24.2 %
:RPS:SCOP  110->232 1e2xA2  a.78.1.1 * 9e-12 15.0 %
:HMM:SCOP  17->122 1v4rA1 a.4.5.6 * 8e-11 34.3 %
:RPS:PFM   26->84 PF00392 * GntR 3e-06 42.4 %
:RPS:PFM   115->232 PF07729 * FCD 1e-07 37.3 %
:HMM:PFM   115->232 PF07729 * FCD 6.5e-24 38.1 118/125  
:HMM:PFM   27->84 PF00392 * GntR 3.3e-12 37.9 58/64  
:BLT:SWISS 11->242 YCBG_BACSU 3e-13 27.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69066.1 GT:GENE BAC69066.1 GT:PRODUCT putative GntR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1672099..1672869 GB:FROM 1672099 GB:TO 1672869 GB:DIRECTION + GB:PRODUCT putative GntR-family transcriptional regulator GB:NOTE PF07729: FCD domain GB:PROTEIN_ID BAC69066.1 LENGTH 256 SQ:AASEQ MPGSDNVPTTGLTALELSGVRRLSALEAVRARIALAVDLGLLSPGERLPGTAQIARALDVSEITARRALVSLCGDGVLERRRGRNGGTLVAAHPTPGTVLTTETYRTATDAVHRLIDHRLALECGIAHLASVRASGEDLSELQEIVEEMDRAPSWAEFHGCDERFHLRLAEATGVPSITGPYGAVLRELYRYYLPYPVDALRASNREHRDLLDALRRQDTAAASEAARHHVETLRHTMFVGLLSASADTGTVAPGS GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 11->242|YCBG_BACSU|3e-13|27.0|226/233| SEG 186->197|lrelyryylpyp| BL:PDB:NREP 1 BL:PDB:REP 23->231|2di3B|1e-06|27.3|205/230| RP:PDB:NREP 1 RP:PDB:REP 4->249|3c7jA|2e-19|18.5|227/232| RP:PFM:NREP 2 RP:PFM:REP 26->84|PF00392|3e-06|42.4|59/64|GntR| RP:PFM:REP 115->232|PF07729|1e-07|37.3|118/125|FCD| HM:PFM:NREP 2 HM:PFM:REP 115->232|PF07729|6.5e-24|38.1|118/125|FCD| HM:PFM:REP 27->84|PF00392|3.3e-12|37.9|58/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 2 RP:SCP:REP 27->94|1e2xA1|1e-10|24.2|66/73|a.4.5.6| RP:SCP:REP 110->232|1e2xA2|9e-12|15.0|120/149|a.78.1.1| HM:SCP:REP 17->122|1v4rA1|8e-11|34.3|99/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 164 OP:NHOMOORG 114 OP:PATTERN -------------------------------------------------------------------- ----1----------------1---7------2212-2221--11-------122--1------1-26--------------3----------------------1-------------------------------------------------------------------------------------1-----------------1111-1---1------------11--------------------------------------------------111---------------------------------------------1------1-----------------11-------------------11-----------------------------1---------1---222-32421333----1-1-1-12--1-------------1----------------------------------1---21-1-----1--------1------1-1-113-1-1--11--2-312-----------------------------1-------------1----------1-------------------------------1------111111--1111-1--1----------------1--------------------1-------------1------------------------1--1----1----------------------------------------------1111------1-----1--1----1-232------------------------------------------------------------------------------------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 246 STR:RPRED 96.1 SQ:SECSTR ###HHHHHHHHHHHHccccccGGGHHHHHHHHHHHHHHTccccTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTcTEEEEccHHHHccGGHHHHcccHHHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHTc####### DISOP:02AL 1-25, 242-256| PSIPRED ccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHHHHHHHcccEEEEEcccEEEEEccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //