[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69068.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  192/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:233 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->233 3dhnA PDBj 3e-21 39.2 %
:RPS:PDB   1->138 2amfA PDBj 2e-06 12.5 %
:RPS:SCOP  5->204 1xq6A  c.2.1.2 * 2e-08 18.0 %
:HMM:SCOP  1->235 1hdoA_ c.2.1.2 * 9.3e-29 33.8 %
:RPS:PFM   5->78 PF05368 * NmrA 7e-06 43.1 %
:HMM:PFM   5->71 PF05368 * NmrA 1e-09 36.4 66/233  
:BLT:SWISS 14->231 YWNB_BACSU 2e-16 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69068.1 GT:GENE BAC69068.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1674152..1674853) GB:FROM 1674152 GB:TO 1674853 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF01370: NAD dependent epimerase/dehydratase family GB:PROTEIN_ID BAC69068.1 LENGTH 233 SQ:AASEQ MHLGVIGATGTIGSRVVTEALARGHHVTAFTRDSTQIDEDRGNVVWKSLDVLDAASVAAGISGLDVLISGFQPGNAAKDIADTVARSIADPTVYATAARSLLKALESHPRTRLIVIGGAGSLEIEPGVVRADSDELLHSSLDALGLPRQYAAAVRGHRDALNVLRTSNRLWTYFSPAEDIAPGERTGRFRTGGDQPVLDAEGRSRISVEDAAVALVDEAELPRFVQRRFTIGY GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 14->231|YWNB_BACSU|2e-16|30.1|193/213| SEG 208->221|vedaavalvdeael| BL:PDB:NREP 1 BL:PDB:REP 5->233|3dhnA|3e-21|39.2|199/210| RP:PDB:NREP 1 RP:PDB:REP 1->138|2amfA|2e-06|12.5|136/257| RP:PFM:NREP 1 RP:PFM:REP 5->78|PF05368|7e-06|43.1|72/234|NmrA| HM:PFM:NREP 1 HM:PFM:REP 5->71|PF05368|1e-09|36.4|66/233|NmrA| RP:SCP:NREP 1 RP:SCP:REP 5->204|1xq6A|2e-08|18.0|183/253|c.2.1.2| HM:SCP:REP 1->235|1hdoA_|9.3e-29|33.8|201/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 217 OP:NHOMOORG 194 OP:PATTERN -----------------------------1-------------------------------------- ----1---------1---------------------1------1---1------1--1--111---22--------------------111----------1---1-1--------------------------------------1------------------------------------11--------12222212212222221-1111222---2--111111222--------------------1----------------------111----------11111111111-------------1-1---111------1111111-1--------------1-----------------------------------111------------------1------1---1--111--1---1111-----1--------------------1--1-------------------------------11---11-11111111111111111111111111111----1---111-1-1--1--1--1-------------------------------------------------1-----------------------111---1-1---111-11-111111-11-----------------11--1----------------------------------1-------------------1------------------------------------------1-----------------------1111-11-1111-------------------11111--11111------------------------------1-1------------------1-----------------1- -------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 94.8 SQ:SECSTR cEEEEEccTcHHHHHHHHHHTTcccEEEEEcccHHHHHHHHTccccccHHHHHHHccEEEEcccGGGHHHHHTTccccccEEEccTTccHHHHHHHHcccccEEEEEccGGGEGGTcEEEEEEEcTTccHHHHHHHHHGGHHHHHHHHHH#########HHHTGGccccEEEEEEcccE#EccccccccEEEccc#cccTTcccEEE#HHHHHHHHHHHHccccccEEEEEEc DISOP:02AL 232-234| PSIPRED cEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHccccccccEEEEEEcccHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHccccccccEEEEcccccccccccccEEEHHHHHHHHHHHHHcccccccEEEccc //