[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69069.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:250 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->241 2oi8A PDBj 8e-08 29.3 %
:RPS:PDB   33->128 3bniB PDBj 2e-14 14.6 %
:RPS:SCOP  33->98 2oi8A1  a.4.1.9 * 6e-12 42.4 %
:RPS:SCOP  206->241 2oi8A2  a.121.1.1 * 2e-04 38.9 %
:HMM:SCOP  22->97 2fd5A1 a.4.1.9 * 4.9e-13 30.3 %
:HMM:SCOP  101->245 1zk8A2 a.121.1.1 * 1.9e-11 27.5 %
:HMM:PFM   36->77 PF00440 * TetR_N 3e-13 40.5 42/47  
:BLT:SWISS 45->130 Y1846_MYCBO 3e-11 38.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69069.1 GT:GENE BAC69069.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1674937..1675689 GB:FROM 1674937 GB:TO 1675689 GB:DIRECTION + GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC69069.1 LENGTH 250 SQ:AASEQ MYGTHHRDAVESATVGKTNGRRERLRAETTAEIKRVALELMATGGPDAITLRAIAREMGMTANAIYGYFATRDDLVTTLINDVYTSLVDTVDTAWETAPAQDPAARIQAWACAFRGWALAGPEGFRLIYGDPVPGYRPPAGGAAPDAAHRVCKGITALAAAAWPHAEHRYADSDFSWSDFDTGLLDKVRPAFPELPPAAVALALRIWSHLHGLISLEIYGHLQTQTLNPDKLFREELAQLIRSLSMTPQG GT:EXON 1|1-250:0| BL:SWS:NREP 1 BL:SWS:REP 45->130|Y1846_MYCBO|3e-11|38.4|86/234| SEG 21->32|rrerlraettae| SEG 132->148|pvpgyrppaggaapdaa| SEG 157->171|alaaaawphaehrya| SEG 190->204|pafpelppaavalal| BL:PDB:NREP 1 BL:PDB:REP 33->241|2oi8A|8e-08|29.3|184/199| RP:PDB:NREP 1 RP:PDB:REP 33->128|3bniB|2e-14|14.6|96/171| HM:PFM:NREP 1 HM:PFM:REP 36->77|PF00440|3e-13|40.5|42/47|TetR_N| RP:SCP:NREP 2 RP:SCP:REP 33->98|2oi8A1|6e-12|42.4|66/79|a.4.1.9| RP:SCP:REP 206->241|2oi8A2|2e-04|38.9|36/124|a.121.1.1| HM:SCP:REP 22->97|2fd5A1|4.9e-13|30.3|76/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 101->245|1zk8A2|1.9e-11|27.5|102/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 48 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ----2------------11-11---111111-1------1-3-4-1-1-----11--1---11-2323121---------------------------------------------------------11---1------1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 77.2 SQ:SECSTR ################################HHHHHHHHHHHHcTTTccHHHHHHHTTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcTTTTTcccTc############cccTTccccGGGTTTTHHHHHHHHHHccccc###cHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHTTTT#TTcccHHHHHHHHHHHHc######### DISOP:02AL 1-31| PSIPRED cccccccHHccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccc //