[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69071.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.68.8
:341 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  14->309 1ofzA_ b.68.8.1 * 8.4e-31 21.6 %
:REPEAT 7|14->49|63->98|112->146|161->195|209->244|258->293|307->341
:REPEAT 6|50->62|99->111|147->160|196->208|245->257|294->306

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69071.1 GT:GENE BAC69071.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1676443..1677468 GB:FROM 1676443 GB:TO 1677468 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69071.1 LENGTH 341 SQ:AASEQ MSGWTLFELSPGGTADPDTGVAAVSRIPGHMEVWWVGPNGSVEGAYWYDGHPWARYQIAPNGSAGGASRITAVSRIPGHMEIWWVGPNGSVEGAYWYDGHPWARYQIAPNGSARRHGITAVSRIPGHMELWWIGPNASVEGAYWYEGSSWARYQIAPNDSAALNGGITAASRIQGSMELWWVGPNESVEGAYWYDGHPWARYQIAPAGSASAVGGITAVSRIPGHMEVWWVSRNESVEGAYWYEGSQWARYQIAPNGSGYRGSDLTVVSRVPGHMELWWTGTDNSVQGAYWYDGHPWARYQLAPAGASSGDGIASVSRIPGSMEVWWLTGRQSIEDGYWYE GT:EXON 1|1-341:0| NREPEAT 2 REPEAT 7|14->49|63->98|112->146|161->195|209->244|258->293|307->341| REPEAT 6|50->62|99->111|147->160|196->208|245->257|294->306| HM:SCP:REP 14->309|1ofzA_|8.4e-31|21.6|287/0|b.68.8.1|1/1|Fucose-specific lectin| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1-------------1-1-------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 341-342| PSIPRED ccccccHHccccEEcccccccEEEEcccccEEEEEEcccccEEEEEEEccccccccEEccccccccccccEEEEcccccEEEEEEEEcccEEEEEEEccccccccEEEccccccccccEEEEcccccEEEEEEcccccEEEEEEEccccccccEEEccccccccccEEEEEcccccEEEEEEcccccEEEEEEEcccccccccccccccccccccEEEEEcccccEEEEEEEccccEEEEEEEccccccccEEcccccccccccccEEEcccccEEEEEEEccccEEEEEEEcccccccEEEEcccccccccccccccccccEEEEEEEccccEEEcEEcc //