[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69072.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  158/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.49.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   22->68 2acjC PDBj 2e-08 12.8 %
:RPS:SCOP  21->92 1f6vA  a.49.1.1 * 3e-09 7.9 %
:HMM:SCOP  5->137 1xd7A_ a.4.5.55 * 7.3e-33 39.4 %
:RPS:PFM   1->81 PF02082 * Rrf2 2e-12 45.7 %
:HMM:PFM   1->81 PF02082 * Rrf2 3.9e-26 51.9 81/83  
:BLT:SWISS 15->90 ISCR_XENNE 7e-11 42.1 %
:PROS 47->65|PS01332|HTH_RRF2_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69072.1 GT:GENE BAC69072.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1677776..1678258) GB:FROM 1677776 GB:TO 1678258 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:NOTE PF02082: Transcriptional regulator GB:PROTEIN_ID BAC69072.1 LENGTH 160 SQ:AASEQ MKMSGGVEWALHCCVVLTSVEEPVPATRLAELHDVSASYLAKQLQALSRAGLVRSVQGKAGGYVLTREPASITVLDVVEAVDGPDQAFTCTEIRQRGPLATPAESCAVPCAIARAMTGADAAWRAALRAVSIADLVQNVRSDSGPGAMAGISAWLSAPDA GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 15->90|ISCR_XENNE|7e-11|42.1|76/164| PROS 47->65|PS01332|HTH_RRF2_1|PDOC01035| SEG 119->133|adaawraalravsia| RP:PDB:NREP 1 RP:PDB:REP 22->68|2acjC|2e-08|12.8|47/66| RP:PFM:NREP 1 RP:PFM:REP 1->81|PF02082|2e-12|45.7|81/83|Rrf2| HM:PFM:NREP 1 HM:PFM:REP 1->81|PF02082|3.9e-26|51.9|81/83|Rrf2| RP:SCP:NREP 1 RP:SCP:REP 21->92|1f6vA|3e-09|7.9|63/91|a.49.1.1| HM:SCP:REP 5->137|1xd7A_|7.3e-33|39.4|127/127|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 213 OP:NHOMOORG 158 OP:PATTERN -------------------------------------------------------------------- -12-2--------------------------------112--1----------21-1---1----121----------111------------------------1-------------------11---1-1-11-------------1-----11--------11112----------------1111--1-33333222131122121221-131---11--11111223----------------------1-----------------11---------------------------------------------------121112222-2---11--11--------1---122---32---------1-11------2--------------------------------111-122-22222211---1----------2---------11--1-1-------------------------------11------2---------------------1-----1------1-1--------11---------------------1------1-111-1----1---1121---------11111------------1-----------------------------------------------1--1--------------------------------------1---1--------------1--------------------------------------------------------111-------11111-----1-1----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 61.9 SQ:SECSTR #######TTHHHHHHHHHcTEccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEcccccEEEEccccHHHHHHHHHHHHGGccEEEEEEEEEEEcccHHHHHHT###################################################### DISOP:02AL 160-161| PSIPRED ccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHcccccHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHcccc //