[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69073.1
DDBJ      :             putative secreted protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  87/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:242 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->156 3c1oA PDBj 3e-06 15.4 %
:RPS:SCOP  5->159 1xq6A  c.2.1.2 * 8e-14 25.3 %
:HMM:SCOP  1->208 2q46A1 c.2.1.2 * 2.6e-31 28.5 %
:RPS:PFM   5->152 PF05368 * NmrA 5e-10 38.7 %
:HMM:PFM   42->172 PF05368 * NmrA 2.1e-09 27.2 125/233  
:HMM:PFM   1->66 PF04321 * RmlD_sub_bind 5.6e-06 26.2 65/287  
:BLT:SWISS 5->98 GNE_ECO57 6e-06 37.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69073.1 GT:GENE BAC69073.1 GT:PRODUCT putative secreted protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1678404..1679132 GB:FROM 1678404 GB:TO 1679132 GB:DIRECTION + GB:PRODUCT putative secreted protein GB:NOTE PF01113: Dihydrodipicolinate reductase, N-terminus GB:PROTEIN_ID BAC69073.1 LENGTH 242 SQ:AASEQ MKFAVIGGTGLIGSQVVKNLNAAGHEAVPHSQSTGIDVISGQGLDQAVAGADVIVNLTNSPTFDEASPAFFQTSMDNLLAAGRKAGVRHFVILSIVGVDQVPELDYYRAKALQEKILAAGPIPYSIVRATQFMEFIDAVLSWTADGDTVRLPATPIQPIAAKDVADAVAEVAAGAPLGGIRNVAGPEIFSLDELGRITLSHKSDGRTVVTDPTAGMFGAVKGDVLTDKDAHLAPTHYADWLS GT:EXON 1|1-242:0| BL:SWS:NREP 1 BL:SWS:REP 5->98|GNE_ECO57|6e-06|37.0|92/331| SEG 160->175|aakdvadavaevaaga| RP:PDB:NREP 1 RP:PDB:REP 1->156|3c1oA|3e-06|15.4|156/314| RP:PFM:NREP 1 RP:PFM:REP 5->152|PF05368|5e-10|38.7|142/234|NmrA| HM:PFM:NREP 2 HM:PFM:REP 42->172|PF05368|2.1e-09|27.2|125/233|NmrA| HM:PFM:REP 1->66|PF04321|5.6e-06|26.2|65/287|RmlD_sub_bind| RP:SCP:NREP 1 RP:SCP:REP 5->159|1xq6A|8e-14|25.3|154/253|c.2.1.2| HM:SCP:REP 1->208|2q46A1|2.6e-31|28.5|207/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 147 OP:NHOMOORG 92 OP:PATTERN -----------------------------111------------------------------------ -11-5---------111-------14------2111-252-1121-1------3--1---111-1251911------------------------------------5-----------------------------------------111----------------------1-----1--------------------------------------------------12----------------------------------------------------------------------------------------------------------------------1---------------------1-------------21---1------------------21--1-1-1---11-33333323-------------------------------------------------------------------111-111111-----1121------1--113-------------1-1--1-----11------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----------------------------------11----------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 64.5 SQ:SECSTR ccEEEETTTcTTHHHHHHHHHHTTccEEEEccccTTccHHHHHHHHHHHHTTcEEEEccTTcHHHccGGGcGGGHHHHHHHHHHccccEEEcccccccGGGccccHHHHHHHHHHHHHHHTcccEEEEccEEHHHHHHHHHcccccccTTccEEEE###################################################################################### DISOP:02AL 242-243| PSIPRED cEEEEEccccHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEccHHcccHHHHHHHHHcccEEEEccccccEEEHHHHHHHHHHHHcccccccEEEEccccEEcHHHHHHHHHHHHccccEEEEccHHHHHHHHHcccccccccccccccHHHHcc //