[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69079.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   111->166 PF04341 * DUF485 3e-07 39.3 %
:HMM:PFM   79->166 PF04341 * DUF485 7.5e-23 30.7 88/91  
:TM
:REPEAT 3|28->37|38->47|48->57
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69079.1 GT:GENE BAC69079.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1686236..1686775 GB:FROM 1686236 GB:TO 1686775 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF04341: Protein of unknown function, DUF485 GB:PROTEIN_ID BAC69079.1 LENGTH 179 SQ:AASEQ MTHADDNRYPPAAPPGWPQPRTAPHENAPRHEPYGYDAPRHDSYGYDTPRRDSYGYDASPYDPYGQAPRHRPSTHEPHRHHADLAALRSAYRVLRRVSTLTALGSFVVYVVLSCYAPDLMGSKIAGELSLGMALGVLQLIVTFAAVLWYGRSAQRSVDPLARVVRERAVRPGRDAEVAR GT:EXON 1|1-179:0| TM:NTM 2 TM:REGION 97->119| TM:REGION 128->150| NREPEAT 1 REPEAT 3|28->37|38->47|48->57| SEG 10->20|ppaappgwpqp| RP:PFM:NREP 1 RP:PFM:REP 111->166|PF04341|3e-07|39.3|56/89|DUF485| HM:PFM:NREP 1 HM:PFM:REP 79->166|PF04341|7.5e-23|30.7|88/91|DUF485| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------1-----------------------------------------------11--1-21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 63-82, 173-179| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccc //