[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69086.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.213.1
:265 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->147 3e4xA PDBj 3e-07 8.1 %
:RPS:SCOP  43->149 2nsfA1  a.213.1.4 * 8e-04 15.0 %
:HMM:SCOP  16->150 1rxqA_ a.213.1.1 * 6.6e-05 19.4 %
:RPS:PFM   157->256 PF07398 * MDMPI_C 5e-05 49.4 %
:HMM:PFM   22->143 PF11716 * MDMPI_N 5.2e-25 29.8 121/140  
:HMM:PFM   156->257 PF07398 * MDMPI_C 1.8e-20 48.1 81/82  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69086.1 GT:GENE BAC69086.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1694414..1695211) GB:FROM 1694414 GB:TO 1695211 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF07398: Protein of unknown function (DUF1503) GB:PROTEIN_ID BAC69086.1 LENGTH 265 SQ:AASEQ MKISDHPDHGSGFAPVDHRTAVAAETARFVAVVKDADLATAVPGCPGWTLADLVKHTGSVQRWFSVLLRARIQEPPQKREVDLRFPDEEGGYADWLAESATVAAEAFAATDPNLPMWAWGVDQHARFWARRMLFETLLHRADAELALGLRPTIDRPLAVDGIDEFLVNLPFAAFFAPKVANLRGPDRTIRFRATDGDDDWLVRLRPDGFGLDTTHPTEDTAAATVRGTATDLLLLAYGRLPYDAEALAHEGDEGLLAHWFANSAF GT:EXON 1|1-265:0| SEG 97->110|aesatvaaeafaat| RP:PDB:NREP 1 RP:PDB:REP 18->147|3e4xA|3e-07|8.1|124/149| RP:PFM:NREP 1 RP:PFM:REP 157->256|PF07398|5e-05|49.4|83/87|MDMPI_C| HM:PFM:NREP 2 HM:PFM:REP 22->143|PF11716|5.2e-25|29.8|121/140|MDMPI_N| HM:PFM:REP 156->257|PF07398|1.8e-20|48.1|81/82|MDMPI_C| RP:SCP:NREP 1 RP:SCP:REP 43->149|2nsfA1|8e-04|15.0|107/160|a.213.1.4| HM:SCP:REP 16->150|1rxqA_|6.6e-05|19.4|134/174|a.213.1.1|1/1|DinB/YfiT-like putative metalloenzymes| OP:NHOMO 40 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- ----4---------11111-11--221-11121111-------1----------------112-1-31311---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 46.8 SQ:SECSTR #################HHHHHHHHHHHHHHTccGGGTTccccT##TccHHHHHHHHHHHHHHHHHHHHTcGGGGGccccccccHHHHHHHHHHHHHHHHHTcTTGGGcEEE####EHHHHcEEEHHHHHHHHHHHHHHHHHHHHHH###################################################################################################################### DISOP:02AL 1-6, 74-86| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccccEEEEEEccccEEEccccccccccEEEEEEcHHHHHHHHHHcccccccccEEEccHHHHHHHHHHccc //