[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69088.1
DDBJ      :             putative membrane transport protein
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  138/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:502 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  48->145 1pv6A  f.38.1.2 * 1e-06 15.3 %
:HMM:SCOP  1->471 1pv7A_ f.38.1.2 * 4.4e-51 26.5 %
:RPS:PFM   33->146 PF07690 * MFS_1 6e-08 28.9 %
:HMM:PFM   23->290 PF07690 * MFS_1 8.6e-27 26.4 216/353  
:HMM:PFM   282->472 PF07690 * MFS_1 5.7e-12 22.6 168/353  
:BLT:SWISS 34->408 TCMA_STRGA 2e-16 27.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69088.1 GT:GENE BAC69088.1 GT:PRODUCT putative membrane transport protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1695483..1696991) GB:FROM 1695483 GB:TO 1696991 GB:DIRECTION - GB:PRODUCT putative membrane transport protein GB:NOTE PF07690: Major Facilitator Superfamily GB:PROTEIN_ID BAC69088.1 LENGTH 502 SQ:AASEQ MSHAQHAVPRRHSGDTVVVLALGLAAMVVSMMQTLVVPVLGIIQSDLEVTTANVSWVTTATLLSAAVFTPLLGRFGDQHGKKPTLVGVLLVMIAGSVLAATTTSLTWLIVGRVMQGAATAIFPLALSVLREEIKPEKLHGAMALVSGTLAFGSGLALVGAGLLTQGSDPDYHRVFWLAVALAVMALAGVLFAVPASRTKTGGRTDWLGAFTLAMLLVLLLLPISQGHEWGWTSGRTLGAFVGAIVMAVVWVITESRVKEPMVDMRMFAHRPVLFTNLAGLLLGFAMFTQFIGVSYLVQMPEDVAGYGFGASVLAASVVYLLPTTLVSLVGAQFGGVLVRRLGARVTLAAGACFGVLGFTWLSAAHDATASVIGAGMVIGLAISFGYASMPALIVASVPAHQTGIANGINSISRSVGSAVASAVITSLLASKTIPLPDGMPALPQESQFTLSFTIAGAAFVLVVAVALVGLKAAHAPRTPVLRKVTQSGTPQSAEVEADAELV GT:EXON 1|1-502:0| BL:SWS:NREP 1 BL:SWS:REP 34->408|TCMA_STRGA|2e-16|27.1|362/538| TM:NTM 13 TM:REGION 19->41| TM:REGION 54->76| TM:REGION 84->106| TM:REGION 109->131| TM:REGION 141->163| TM:REGION 174->195| TM:REGION 205->227| TM:REGION 235->256| TM:REGION 275->297| TM:REGION 310->332| TM:REGION 342->364| TM:REGION 373->395| TM:REGION 451->473| SEG 17->32|vvvlalglaamvvsmm| SEG 149->166|lafgsglalvgaglltqg| SEG 177->193|lavalavmalagvlfav| SEG 212->221|lamllvllll| SEG 410->426|sisrsvgsavasavits| SEG 455->475|agaafvlvvavalvglkaaha| RP:PFM:NREP 1 RP:PFM:REP 33->146|PF07690|6e-08|28.9|114/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 23->290|PF07690|8.6e-27|26.4|216/353|MFS_1| HM:PFM:REP 282->472|PF07690|5.7e-12|22.6|168/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 48->145|1pv6A|1e-06|15.3|98/417|f.38.1.2| HM:SCP:REP 1->471|1pv7A_|4.4e-51|26.5|389/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 338 OP:NHOMOORG 172 OP:PATTERN ------5122222242-1111--1---------------------------------11--211---- 1--1C1-13331-1111----3--34-----145565AFA-B1B-111---13231-2--11211-1758311111----1-------------------------------------------------------33311---2----------------------------------------------11122222132-222212--1-21222-----11------23----------------------1-11---------111-2------------------------------------------------------1-------1----------------------1-----111---------1---------111-----------11-111111-----------------11-1-----1--------------------------------------------------------------1--1-1--------------1------1----1-1--111---------11--------------------------------------------------1----------------------------------------------------------------------------1----------------------------------1-111---------------------------------------------1--1--------------------------------------------------11--------------------------------------------------------------------------------------1----------- -------------------1---------1111-------1----------------------------1--------------1----1----1111-1--------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 473-496| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc //