[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69089.1
DDBJ      :             putative MarR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->139 2nyxB PDBj 2e-08 34.7 %
:RPS:PDB   11->136 2a61A PDBj 3e-13 24.6 %
:RPS:SCOP  36->140 2bv6A1  a.4.5.28 * 6e-19 26.9 %
:HMM:SCOP  1->140 1jgsA_ a.4.5.28 * 1.2e-23 31.1 %
:HMM:PFM   36->92 PF01047 * MarR 1.1e-16 47.4 57/59  
:HMM:PFM   6->63 PF01900 * RNase_P_Rpp14 0.00035 19.0 58/107  
:BLT:SWISS 20->138 HCRR_THAAR 4e-09 31.9 %
:PROS 67->101|PS01117|HTH_MARR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69089.1 GT:GENE BAC69089.1 GT:PRODUCT putative MarR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1697123..1697560 GB:FROM 1697123 GB:TO 1697560 GB:DIRECTION + GB:PRODUCT putative MarR-family transcriptional regulator GB:NOTE PF01047: MarR family GB:PROTEIN_ID BAC69089.1 LENGTH 145 SQ:AASEQ MTGTPRIDTAQLMELLSVSLAAYYGDFTVAAASESLTASQGKTLNVLRRGPASMSVLATTLTCDASNMTGIVDRLEKRGLVRREPSPSDRRVKNVILTAEGERVIDVIRGKMHATLAGLNRLSAQERDTLYALLERAFTAQLAAA GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 20->138|HCRR_THAAR|4e-09|31.9|119/166| PROS 67->101|PS01117|HTH_MARR_1|PDOC00861| BL:PDB:NREP 1 BL:PDB:REP 16->139|2nyxB|2e-08|34.7|118/145| RP:PDB:NREP 1 RP:PDB:REP 11->136|2a61A|3e-13|24.6|126/142| HM:PFM:NREP 2 HM:PFM:REP 36->92|PF01047|1.1e-16|47.4|57/59|MarR| HM:PFM:REP 6->63|PF01900|0.00035|19.0|58/107|RNase_P_Rpp14| RP:SCP:NREP 1 RP:SCP:REP 36->140|2bv6A1|6e-19|26.9|104/136|a.4.5.28| HM:SCP:REP 1->140|1jgsA_|1.2e-23|31.1|135/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 47 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----3---------1-----------------------1--212-1-------11------------211------------------------------------------------------------------222-----1--------11-----------1-----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------1---------------------1--------1------1----------------------------------------------------------------------------2-----------------------1-------1------------------------1-----------------1-1----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------1--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 98.6 SQ:SECSTR ##cccHHHHHHHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHEEccHHHH DISOP:02AL 1-2, 143-145| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccc //