[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69104.1
DDBJ      :             putative multiple sugar ABC transporter solute-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  90/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:533 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   100->338 2gh9A PDBj 9e-14 33.2 %
:RPS:PDB   81->429 2b3bA PDBj 3e-16 13.2 %
:RPS:SCOP  100->527 1j1nA  c.94.1.1 * 1e-20 12.0 %
:HMM:SCOP  22->527 1y3nA1 c.94.1.1 * 1.7e-54 26.2 %
:RPS:PFM   101->365 PF01547 * SBP_bac_1 2e-08 32.9 %
:HMM:PFM   100->415 PF01547 * SBP_bac_1 1.9e-14 20.9 268/314  
:BLT:SWISS 75->412 Y4OP_RHISN 6e-16 28.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69104.1 GT:GENE BAC69104.1 GT:PRODUCT putative multiple sugar ABC transporter solute-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1720293..1721894 GB:FROM 1720293 GB:TO 1721894 GB:DIRECTION + GB:PRODUCT putative multiple sugar ABC transporter solute-binding protein GB:NOTE malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 GB:PROTEIN_ID BAC69104.1 LENGTH 533 SQ:AASEQ MRTRPYKRFAAVAAVAALTATACTAPDQAQEGPKDKAPLFKLGSQISYEKYGKDYPDTKVEDVPGPCSYEAISRKDYSGQTLKIISHAVPVIGEPTQLHAKQFEEITGAKVEVVNVPFGELHQKILTPLQAGQPAYDVMFYPSLWIGDLAPYLAPVPKKYLNTPGMKDVTGTYMDVATWNRKVVQYPMDGDRHYLKVRTDVLNDPKQQAAYKAATGKELRVPKTWDEYQDVAKFFSGKDFDGDGKRNYGSAEVTKRDDLTFSAFISRAAPYVKNPDVKGGVFFDLETMKPLINTPGFVRALDDMVKAKSTWAPGGANFGLGDEIFSFGGGQTLMSYSWDDAFIQAQQPDSRIRNKVQAAPLPGSSEVYNRTTKSWDTKANQAPYFTWGWTSAVAKASRHQQMAFDYLCFFSNEANTALDLTIGRFGVNPYRYSHFDPSFWERLGWDPKVAKSYVKTLSGMEESRNRVFDLRVPGVNQYMSALANGVAAALAGQDSPQDALDGVAGEWSKITGQIGKDKVQSAYRNVVALEDNS GT:EXON 1|1-533:0| BL:SWS:NREP 1 BL:SWS:REP 75->412|Y4OP_RHISN|6e-16|28.6|294/431| SEG 10->25|aavaavaaltatacta| SEG 481->492|alangvaaalag| BL:PDB:NREP 1 BL:PDB:REP 100->338|2gh9A|9e-14|33.2|205/378| RP:PDB:NREP 1 RP:PDB:REP 81->429|2b3bA|3e-16|13.2|310/392| RP:PFM:NREP 1 RP:PFM:REP 101->365|PF01547|2e-08|32.9|231/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 100->415|PF01547|1.9e-14|20.9|268/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 100->527|1j1nA|1e-20|12.0|400/492|c.94.1.1| HM:SCP:REP 22->527|1y3nA1|1.7e-54|26.2|427/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 140 OP:NHOMOORG 94 OP:PATTERN -------------------------------------------------------------------- -------------------------1-----------------11-------111------------1-----------------------------------------------------------------------------2----------------------------------------1112-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------222---21111----------1---1-----13--211363466422------111112312---------------1-----------------------------1------1111-------------11---------1111--111--1--1-2111------------------------1---1----------------------1---------------------------------------1-------1---------1----------------------------------------------------------------------------------------------------------------2-1---------------------------------1111111-111-------------------------------------------------------------------------------------11--11-21--- ------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------23---------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 445 STR:RPRED 83.5 SQ:SECSTR #############################################################################cTTEEEEEEcccGGGcHHHHHHHHHHHHcTTcEEEEEEcccGHHHHHHHHHHHTTccccEEEEETTHHHTTTTTcccccHHHHHHHTHHHHccHHHHHHTEETTEEccEEcccEEccEEEEcHHHHHHHHHHTcccEEETTccccccHHHHHHHHHHHHHTTccccEEcccHHHHHHcccEcccHHHHHHHHHHHHHHHHHHHHHHHHHHTcccTTcHHHHHHHHHHHHHHTTccTTGGGccHHHHHHHHHHTcccEEEccTHHHHHHHHTTccEccccTTTcEEEEcTTcTTEEEcEEcTTcTTEEEEEcEEEcccTTcTTHHHHHHHHHHHcHHHHHHHHHHHccccccTcHHHHHHHTTcHHHHHHHHHHHHHHcEEccccTTHHcEEccccTTHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHEEEEEcccEEEEE########### DISOP:02AL 1-4, 46-58, 531-533| PSIPRED ccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccHHHHHHHHHHccccccccHHcccccccccEEEEEEEHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHccccccccccHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEHHHHHcccccHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccEEccccccccHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccEEEEEccHHHHHHHccHHHHccccEEEEEccccccccccccccccccccccccEEccEEEEEEcccccHHHHHHHHHHHHcHHHHHHHHHHccccccccHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //