[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69113.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->53 PF07282 * Transposase_35 0.0005 33.3 33/69  
:HMM:PFM   64->118 PF07005 * DUF1537 0.0005 27.3 55/223  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69113.1 GT:GENE BAC69113.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1731053..1731502 GB:FROM 1731053 GB:TO 1731502 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69113.1 LENGTH 149 SQ:AASEQ MTACQPAEQGSSSRAARAEPVKSFNRALASSTCAACLSLHVSVPAPRRLSACQEKRSDKAMPRAVVRASADSTTAVDPSTATVDAARRAALTRFSAALMRSIASSRCTGPAPLSAVQAPRKPSSAATASVISALYAAWRTSRRHRWCSK GT:EXON 1|1-149:0| SEG 27->39|alasstcaaclsl| HM:PFM:NREP 2 HM:PFM:REP 20->53|PF07282|0.0005|33.3|33/69|Transposase_35| HM:PFM:REP 64->118|PF07005|0.0005|27.3|55/223|DUF1537| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-21, 50-62, 117-124, 148-149| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccc //