[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69118.1
DDBJ      :             putative racemase
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  261/915 : Eukaryota  46/199 : Viruses  0/175   --->[See Alignment]
c.1.11d.54.1
:365 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->353 1rvkA PDBj 3e-44 37.8 %
:RPS:PDB   1->350 3eezA PDBj 4e-39 23.1 %
:RPS:SCOP  28->127 1rvkA2  d.54.1.1 * 1e-19 37.1 %
:RPS:SCOP  128->353 1rvkA1  c.1.11.2 * 9e-43 36.0 %
:HMM:SCOP  1->129 1yeyA2 d.54.1.1 * 1.7e-26 33.3 %
:HMM:SCOP  114->356 2gl5A1 c.1.11.2 * 1.7e-48 33.1 %
:RPS:PFM   28->126 PF02746 * MR_MLE_N 4e-04 31.2 %
:RPS:PFM   146->222 PF01188 * MR_MLE 1e-06 35.1 %
:HMM:PFM   145->240 PF01188 * MR_MLE 1.4e-25 31.2 96/98  
:HMM:PFM   36->126 PF02746 * MR_MLE_N 1.5e-10 29.5 88/117  
:BLT:SWISS 97->340 RHAMD_SALPK 1e-18 33.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69118.1 GT:GENE BAC69118.1 GT:PRODUCT putative racemase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1738439..1739536 GB:FROM 1738439 GB:TO 1739536 GB:DIRECTION + GB:PRODUCT putative racemase GB:NOTE PF01188: Mandelate racemase / muconate lactonizing enzyme, C-terminal domain GB:PROTEIN_ID BAC69118.1 LENGTH 365 SQ:AASEQ MKITHVEVHRIDVPAASPPFRWRDGLSGSAPVGDGAVLHIGTDEGAEGVSVFARPGAYSTLRDLVDRVFRAELVGADPFQREWLWHRVWELDRIHELPLPTLGLIDIALWDLAGRYHGEPVWRLLGGFREAIPAYASTSTFSSVAEFLDVADQCLALGYRGIKLHAWGDARRDAELCLALRDHVGPDVPLMYDGSAGFDLPDAIRLGRALSEADYLWYEEPIREFSISAYQRLAEAVDVPLLVAETSDGAHMNAADFIRAGAATFGVRAGTTLRGGITGAMRTAHLADAFRLRAEVHGSDIPNHHLCMAISNTTYYESLVTSVNVVRERHVDDQGLVHAPAGPGIALPLDFGYGNELLPFVEQPR GT:EXON 1|1-365:0| BL:SWS:NREP 1 BL:SWS:REP 97->340|RHAMD_SALPK|1e-18|33.0|230/405| BL:PDB:NREP 1 BL:PDB:REP 38->353|1rvkA|3e-44|37.8|307/370| RP:PDB:NREP 1 RP:PDB:REP 1->350|3eezA|4e-39|23.1|333/363| RP:PFM:NREP 2 RP:PFM:REP 28->126|PF02746|4e-04|31.2|96/110|MR_MLE_N| RP:PFM:REP 146->222|PF01188|1e-06|35.1|77/98|MR_MLE| HM:PFM:NREP 2 HM:PFM:REP 145->240|PF01188|1.4e-25|31.2|96/98|MR_MLE| HM:PFM:REP 36->126|PF02746|1.5e-10|29.5|88/117|MR_MLE_N| RP:SCP:NREP 2 RP:SCP:REP 28->127|1rvkA2|1e-19|37.1|97/126|d.54.1.1| RP:SCP:REP 128->353|1rvkA1|9e-43|36.0|225/255|c.1.11.2| HM:SCP:REP 1->129|1yeyA2|1.7e-26|33.3|129/0|d.54.1.1|1/1|Enolase N-terminal domain-like| HM:SCP:REP 114->356|2gl5A1|1.7e-48|33.1|236/0|c.1.11.2|1/1|Enolase C-terminal domain-like| OP:NHOMO 665 OP:NHOMOORG 332 OP:PATTERN 11--1-232333233313-----13--1-112-----------------------------2212--- 1-D-1----------11----1---4-------1111112--111A------324-----1-2-3-626-1-----------2-----------------------12-1--------------------------1--12----5-1--111--11---1--------1-------------11-11----1211111111-1111111-221111111221-1------331----------------------------------11------------------------------------------------------1111-----------1----------------1---------11-1-1---------------322--------11111111111---1--5--A5--577-62188644112--1111-21426-------------------------------------------------11-32134332351----225332231-315342--------1--417-55-------------------2---1-----------------------1--11-------------------------------11-11-41--------1------1-------1----------233-3-2111222212-122131211112122222234333---515453555334543511-----1------------------------------3--------------------------1-1111-112---1--221-----------------------1111-1--111----------------------------------------------------1---------- ------1--------1111---22223------111----------12111131-1111111-11-------111----------------11---111---------1-------------------------------------------------1----21-----------------------21---1----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 363 STR:RPRED 99.5 SQ:SECSTR ccEEEEEEEEEEEEcccccccccTEEEEEEEEEEEEEEEEEETTcccEEEEEEcccccccccccHHHHHHHHHTTccTTcHHHHHHHHHHHccccTcHHHHHHHHHHHHHHHHHHHTTccHHHHTTccccccEEcccccccccHHHHHHHHHHHHHTTccEEEEEccccHHHHHHHHHHHTTcccTTcEEEEEcTTcccHHHHHHHHHHTGGGTccEEcccccHTcHHHHHHTGGGccccEEEcTTcccHHHHHHHHHHTTcccEEEEEEHHHHTcHHHHHHHHHHHHHTTcEEEEEccHHHHHHHHHTccGGGcccccccGGGccccTTTTcTTEEcccccccTcccccHHHccccEEEEHH## DISOP:02AL 363-365| PSIPRED cEEEEEEEEEEEEEccccccHHHHHcccEEEEEEEEEEEEEEccccEEEEEEcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHccccEEEcccEEccHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHccccHHcccccccHHHcccccEEEccEEEccccccccEEEcHHHHHHHcccccccc //