[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69120.1
DDBJ      :             putative ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  379/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:310 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   117->260 2r6gF PDBj 1e-11 28.7 %
:RPS:PDB   197->223 3dhwA PDBj 2e-07 33.3 %
:RPS:SCOP  108->278 2r6gF2  f.58.1.1 * 7e-11 26.3 %
:RPS:PFM   118->249 PF00528 * BPD_transp_1 2e-07 32.8 %
:HMM:PFM   101->299 PF00528 * BPD_transp_1 1.1e-15 24.0 171/185  
:HMM:PFM   73->128 PF11915 * DUF3433 0.00013 21.8 55/699  
:BLT:SWISS 63->262 YURN_BACSU 3e-15 24.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69120.1 GT:GENE BAC69120.1 GT:PRODUCT putative ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1740951..1741883 GB:FROM 1740951 GB:TO 1741883 GB:DIRECTION + GB:PRODUCT putative ABC transporter permease protein GB:NOTE PF00528: Binding-protein-dependent transport system inner membrane component GB:PROTEIN_ID BAC69120.1 LENGTH 310 SQ:AASEQ MTLLETEPVAVSPVRRGTTPRRTGRGRAGYFFVAGYALLLLAFGVFPTGYAFYLALTNDRGQFTGLNQFVKVVQDYRFAPAFTHMLIYLVMWLVTLVVLVVLTAVVLRSRVRPGTSALFRFLYYIPGALAGVASVLVWLFMLDPDVSPVSWLLTAMGLKTFAAVLAPGNLPLILMLIAFWTGAGGWMVVMYGALNNIPDDVLEAARMDGAGPWRTAWHIQIPMIRQWIVYMTIMAFATGTQLFVEPQLLQTASLGRVSPTWSPNQLAYVYAFQQGDFNGAAAISVVLLAVGLLAAGLLVARSNLFKLDEK GT:EXON 1|1-310:0| BL:SWS:NREP 1 BL:SWS:REP 63->262|YURN_BACSU|3e-15|24.0|200/292| TM:NTM 6 TM:REGION 31->53| TM:REGION 83->105| TM:REGION 123->145| TM:REGION 167->189| TM:REGION 219->240| TM:REGION 280->302| SEG 15->27|rrgttprrtgrgr| SEG 89->107|lvmwlvtlvvlvvltavvl| SEG 279->300|gaaaisvvllavgllaagllva| BL:PDB:NREP 1 BL:PDB:REP 117->260|2r6gF|1e-11|28.7|143/490| RP:PDB:NREP 1 RP:PDB:REP 197->223|3dhwA|2e-07|33.3|27/203| RP:PFM:NREP 1 RP:PFM:REP 118->249|PF00528|2e-07|32.8|122/195|BPD_transp_1| HM:PFM:NREP 2 HM:PFM:REP 101->299|PF00528|1.1e-15|24.0|171/185|BPD_transp_1| HM:PFM:REP 73->128|PF11915|0.00013|21.8|55/699|DUF3433| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 108->278|2r6gF2|7e-11|26.3|171/244|f.58.1.1| OP:NHOMO 1102 OP:NHOMOORG 397 OP:PATTERN 11--1-----------1-1111-----1--------------------------111111-111---- ----I--2-------2222-2-2222222222--------2--1BhK-6981FC7--2--44365-4DG8112226871---1-----------------------------------------------------56655---32121311---11-11111221-333-------------8611265-52211111122--11111F5331311221514-33233228V1-------------------12--22------1--22---1----1-1-----11123334342223-------------121---222223--3111111111131---1-29-12-214--------9---34431-1--------------443---1122122222222225---1-----35--C996BA6IGF78-----1322212211-----------1-------------------------------------2-1-----2212---11111121111111--1111--1113----111143-------2--------------------------------------11-1-1-----------------------------112-------1--------------------------------123211-1111111111-111111121111111111-121121111111111111111111--1--11---144444454444-------------1-226-------------------------------1---------1-1-------------1-----1-211--111111111111----------------------------------------------1B3244F344-2- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 46.1 SQ:SECSTR ####################################################################################################################HHHHHHTTHHHHccHHHHHHHHHHHTcccccHHHHHHHHTcccc#cTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGccTTTTTHHHHHTccTHHHHHHTTHHHTHHHHHHHHHHHHHHHHTcHHHHHHHccccccccccc################################################## DISOP:02AL 7-27, 306-310| PSIPRED ccEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //