[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69121.1
DDBJ      :             putative ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  555/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:304 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   87->303 2r6gG PDBj 3e-14 29.4 %
:RPS:PDB   180->216 3dhwA PDBj 5e-08 40.0 %
:RPS:SCOP  50->250 2r6gG1  f.58.1.1 * 2e-18 23.2 %
:RPS:PFM   105->233 PF00528 * BPD_transp_1 3e-08 36.5 %
:HMM:PFM   107->297 PF00528 * BPD_transp_1 8.8e-22 24.4 176/185  
:BLT:SWISS 62->249 LPLC_BACSU 6e-24 33.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69121.1 GT:GENE BAC69121.1 GT:PRODUCT putative ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1741880..1742794 GB:FROM 1741880 GB:TO 1742794 GB:DIRECTION + GB:PRODUCT putative ABC transporter permease protein GB:NOTE PF00528: Binding-protein-dependent transport system inner membrane component GB:PROTEIN_ID BAC69121.1 LENGTH 304 SQ:AASEQ MTQTAVFLTAVRRRIRPSRTLPFLVVGLLLALLLLFFVLPVIWLLLTPSKTAGEVVRDNPLSFGSFHQIGTAWRHLFAFQDGAMTRWLRNSAVYSGGSLILTLAVSVPAGYALALTNFRGRKTLLVITLVTMIMPQATLVLPIFLELNRFHLIGTIWSVILPFSFYPFGVYLVYIYFGSSLPRDLLSAARIDGCTEWQLFSRIALPLAKPVVGLVAFFSFVGNWNNFFLPYLVLPNSEQFPVQVGLNQLLTSTPSFNPVAGAGLNVTIPELALAILIAILPVLVLFVFSQRTLVSGMLAGASKE GT:EXON 1|1-304:0| BL:SWS:NREP 1 BL:SWS:REP 62->249|LPLC_BACSU|6e-24|33.0|185/295| TM:NTM 6 TM:REGION 24->46| TM:REGION 94->116| TM:REGION 123->145| TM:REGION 157->179| TM:REGION 200->222| TM:REGION 264->286| SEG 21->46|lpflvvglllallllffvlpviwlll| SEG 271->288|lalailiailpvlvlfvf| BL:PDB:NREP 1 BL:PDB:REP 87->303|2r6gG|3e-14|29.4|204/284| RP:PDB:NREP 1 RP:PDB:REP 180->216|3dhwA|5e-08|40.0|35/203| RP:PFM:NREP 1 RP:PFM:REP 105->233|PF00528|3e-08|36.5|126/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 107->297|PF00528|8.8e-22|24.4|176/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 50->250|2r6gG1|2e-18|23.2|198/284|f.58.1.1| OP:NHOMO 2994 OP:NHOMOORG 589 OP:PATTERN 11--3--12312223161321---5--3--3-----------------------23531-1422---- ---1e212333-1123344-413348444443144414565427H*V2CHF2NKL12A--865AE4DOUH58666GB8----4-------------------------1---------------------------89967---7511-311-11111111112221333--1-----1----DE244DE-953222222331122222RI994822354A17457787779*111111111111111-1---531123--22233--22---1-42552325344411666777766664333344443333344---4443F4-381112122524D2--1445e-26233A--231--1J--1675J2-1-------11111--DA81--335533355355555F---5--4-19L--UUUJVTOefYQO22---8F97457B85--------2112---1---------------------------------2-144434554544233333684443335462223--2236-23342667E----1--3--------------1-1--111--11111---------111124----------1------------------125-----1-4----------------------1---------26761413333333333-33333334333323333325656611123222222222222226-113332--488888888787---------11111-56C---112--------1----------1-22222233322232434----------1222222223153311111111111111-------------------181-11------11----1---2----6KEB89S9DA-2- -------------2------------------------------------------------------------------------------------------------------------------------------------------------2-----------1--------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 67.1 SQ:SECSTR ######################################################################################HHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTcHHHHHHHHHTTccccccHHHHHHHHHHHTccTTcHHHHHHHHTTTHHHHHHHHHHH#THccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHcccGGGccHHHHGGGGccccccHHHHHHHHHHTHHH############HHHHHHHHTTTccccccTTTcc# DISOP:02AL 8-19| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //