Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69126.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69126.1 GT:GENE BAC69126.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1748025..1748549 GB:FROM 1748025 GB:TO 1748549 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69126.1 LENGTH 174 SQ:AASEQ MTAGAMALSGAFGSGPDSGPRGPVEAEALSAFPLENTTDWVSYGDHVAVIHVDNEKISPVPDKAKEHGEGHVDRTGRVVIDKVLYNRSGSPELPSSFTTQLAGLWWEDGVGTREFNFRGTSRLESGHSYIAVLVWDEDVQGFEAAALGGVLPFDKGTVGLGEIDGKTRQSLPPD GT:EXON 1|1-174:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-8, 13-22, 168-174| PSIPRED cccccEEEEccccccccccccccccHHHHHcccccccccHHccccEEEEEEEcccccccHHHHHHHHEEEEEEEEEEEEEEEEEEcccccccccccccccccccEEEcccccEEEEEccEEEEEEccEEEEEEEEccccHHHHHHHccccccccccEEEccccccccccccccc //