[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69127.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:246 amino acids
:PSIPRED
:DISOPRED
:REPEAT 2|46->55|58->67

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69127.1 GT:GENE BAC69127.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1748916..1749656 GB:FROM 1748916 GB:TO 1749656 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69127.1 LENGTH 246 SQ:AASEQ MEDLRRSGWSSAPCVPLAWGGSTVTSDHDLLWRRCAHLGRVLLPVVDEEAWRQARLLVHQEAWRQARRHEHLEAWGINIVEGERLIELFAALAAHAVTVDISASAAEIDVLPPSVVADAATGKRDLELLAGLPDTFADGRDELAVKVFRLYTYRGGQYSRRLFQLSTELRRALIVLRGTRNARILAFAGSASLLDTPAPVEHQRPHAAHHLRTAPVLIRRGVKSGQDYGTCPRATTRKASLRRRCL GT:EXON 1|1-246:0| NREPEAT 1 REPEAT 2|46->55|58->67| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 63-66, 196-203| PSIPRED cccHHHccccccccEEEEEccccccccHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccHHHHHHHHcccHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccHHccccccccccccccccccccccHHHccccccEEEEcccccccccccccHHHHHHHHHHHHcc //