[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69128.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  481/915 : Eukaryota  12/199 : Viruses  1/175   --->[See Alignment]
b.52.2f.38.1
:477 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   143->235 2d33D PDBj 2e-06 8.1 %
:RPS:SCOP  115->190 1wlfA2  b.52.2.3 * 6e-07 18.4 %
:HMM:SCOP  1->459 1pw4A_ f.38.1.1 * 1.4e-66 25.6 %
:RPS:PFM   37->233 PF00083 * Sugar_tr 3e-11 37.8 %
:HMM:PFM   36->459 PF00083 * Sugar_tr 3.3e-35 22.0 410/451  
:BLT:SWISS 31->400 SHIA_ECOLI 2e-70 38.3 %
:PROS 144->169|PS00217|SUGAR_TRANSPORT_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69128.1 GT:GENE BAC69128.1 GT:PRODUCT putative transporter GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1750041..1751474 GB:FROM 1750041 GB:TO 1751474 GB:DIRECTION + GB:PRODUCT putative transporter GB:NOTE PF00083: Sugar (and other) transporter GB:PROTEIN_ID BAC69128.1 LENGTH 477 SQ:AASEQ MSGHVPVPTEHPEVVHMASAATAPPPPASLKRIVAASLIGTTIEWYDFFLYGSAAALVFNKLFFPGSDPLVGTLLSFLTYAVGFAARPLGALVFGHYGDRLGRKKLLVLSLLLMGGATFAIGLLPTHSTVGSAAPVLLTTLRLVQGFALGGEWGGAVLLVSEHGDARRRGFWASWPQTGAPAGQLLATGVLSLLTAVLSDAAFVSWGWRIPFLLSGVLVIVGLWIRLSVDESPVFQQALARAEARSAAPDAVAEKLPLVSVLRHHWRDVLVAMGARMAENISYYVITAFILVYATTSAGVSRQTALNAVLIASAVHFAVIPAWGALSDRIGRRPVYLLGAAGVGLWMFPFFSLIDTGGFGNMILAVTVGLVLHGAMYAPQAAFFSEMFATRMRYSGASIGAQFASVAAGAPAPLIATALLSDYGNSTPISLYVIAAVVLTLIAVGAAKETRSRDLAAVDPVTDAEPAAARAADAPAV GT:EXON 1|1-477:0| BL:SWS:NREP 1 BL:SWS:REP 31->400|SHIA_ECOLI|2e-70|38.3|363/438| PROS 144->169|PS00217|SUGAR_TRANSPORT_2|PDOC00190| TM:NTM 13 TM:REGION 36->58| TM:REGION 77->99| TM:REGION 106->128| TM:REGION 130->151| TM:REGION 181->203| TM:REGION 208->230| TM:REGION 254->276| TM:REGION 279->301| TM:REGION 306->328| TM:REGION 334->356| TM:REGION 358->380| TM:REGION 398->420| TM:REGION 428->449| SEG 4->16|hvpvptehpevvh| SEG 18->29|asaatappppas| SEG 100->113|rlgrkkllvlslll| SEG 238->253|alaraearsaapdava| SEG 401->418|aqfasvaagapapliata| SEG 433->447|viaavvltliavgaa| SEG 463->476|daepaaaraadapa| RP:PDB:NREP 1 RP:PDB:REP 143->235|2d33D|2e-06|8.1|86/499| RP:PFM:NREP 1 RP:PFM:REP 37->233|PF00083|3e-11|37.8|180/433|Sugar_tr| HM:PFM:NREP 1 HM:PFM:REP 36->459|PF00083|3.3e-35|22.0|410/451|Sugar_tr| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00083|IPR005828| GO:PFM GO:0006810|"GO:transport"|PF00083|IPR005828| GO:PFM GO:0016021|"GO:integral to membrane"|PF00083|IPR005828| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00083|IPR005828| RP:SCP:NREP 1 RP:SCP:REP 115->190|1wlfA2|6e-07|18.4|76/84|b.52.2.3| HM:SCP:REP 1->459|1pw4A_|1.4e-66|25.6|425/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 2711 OP:NHOMOORG 514 OP:PATTERN ------3858887685-6233421-------------------------------------113---- -11-131587C-2154433-37--2U3333325999DNno--224-1-1441PJL726-----328Q76311111222-13-A--111--------1--1-2---2-2-2-----------------1-1---1-------11111--------------131---------1-----1-----1--------1222222211222222------222-23--1-------1-1111111111111111-112----11-2-----11-----11--------------------------------------------------------------------------------------------------1--44461442452F551-32323244444443435-66B55G7C221-666622444544B4-----5-----1-32333333344121-1442334441122569A65F5575573223-1564-63345WOOVQSCFIIEUUaNKMKICIWJYAGDB-5FC832522611-8336---1141-------11--1-1--1----21--------------111111-----1-5455341-2222212-------1-1---------------1--------------1---------77782774668577755-665567555667555455678766--27757776777667677944643441-322222222222----11111575711-11-------22211--188889571125-99B8BED91EFFF-B9A955449555----------1----55545444451111---------------------------------------------------------1- -------------------------------------------------------------------------------------------------------1-1--6------------------------------------------------------3------------11-----1----1---231---1 --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- STR:NPRED 86 STR:RPRED 18.0 SQ:SECSTR ##############################################################################################################################################EETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEE#######EEccTTcTTcccHHHHHHHHHHHHHHHHcccccc################################################################################################################################################################################################################################################## DISOP:02AL 1-27, 236-255, 456-477| PSIPRED cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccccccccccccccccc //