[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69131.1
DDBJ      :             putative MutT-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  128/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->114 3edsA PDBj 4e-11 46.2 %
:RPS:PDB   4->134 3edsA PDBj 5e-19 26.4 %
:RPS:SCOP  16->141 1sjyA  d.113.1.1 * 2e-17 22.3 %
:HMM:SCOP  14->142 2fmlA2 d.113.1.6 * 3.2e-31 36.5 %
:RPS:PFM   22->134 PF00293 * NUDIX 6e-12 40.0 %
:HMM:PFM   21->138 PF00293 * NUDIX 1.5e-24 35.7 115/135  
:BLT:SWISS 24->146 MUTT_STRAM 7e-10 35.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69131.1 GT:GENE BAC69131.1 GT:PRODUCT putative MutT-like protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1754407..1754880) GB:FROM 1754407 GB:TO 1754880 GB:DIRECTION - GB:PRODUCT putative MutT-like protein GB:NOTE PF00293: NUDIX domain GB:PROTEIN_ID BAC69131.1 LENGTH 157 SQ:AASEQ MATPDFIRTIRASAGHQLLWLPGVTAIVLDDDGRVLLGRRSDTRTWSVIGGIPDPGEQPAACAVREVYEETAVRCVVERVVLVQALEPVTYDNGDTCQYMDITFRCRAVGGEARVNDDESLEVGWFPLDALPELNEFGLLRIKQALSDGPTWFDPMT GT:EXON 1|1-157:0| BL:SWS:NREP 1 BL:SWS:REP 24->146|MUTT_STRAM|7e-10|35.1|114/154| SEG 72->87|avrcvvervvlvqale| BL:PDB:NREP 1 BL:PDB:REP 6->114|3edsA|4e-11|46.2|104/132| RP:PDB:NREP 1 RP:PDB:REP 4->134|3edsA|5e-19|26.4|121/132| RP:PFM:NREP 1 RP:PFM:REP 22->134|PF00293|6e-12|40.0|110/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 21->138|PF00293|1.5e-24|35.7|115/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 16->141|1sjyA|2e-17|22.3|121/154|d.113.1.1| HM:SCP:REP 14->142|2fmlA2|3.2e-31|36.5|126/0|d.113.1.6|1/1|Nudix| OP:NHOMO 200 OP:NHOMOORG 128 OP:PATTERN -------------------------------------------------------------------- ----111111-111221----2--1--------2121111-221-11--1111111-1--11112--12111111111----------------------------------------------------------11111--------------------------------------------3-------14443443515453441-----5541--2--1------1-------------------------22----111--22------213111-111-11-----------11111111111111--------------1111111-1---------------11----------------------------------11--------------------------------1-----------------------------------------------------------------------------------11------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 97.5 SQ:SECSTR EEEcHHHHHHHHHHTTccEEEEEEEEEEccTTccEEEEcccTTccccccEEEccTTccHHHHHHHHHHHHHcEEEEEEEEEEEEccGGGEEEcTEEEETTccEEEEEEEEEEEEEEEEccccEEEEcGGGcccccccHHHHHHHHHHHHHHHH#### DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHccccEEEEEEEEEEEEccccEEEEEEccccEEEcccccccccccHHHHHHHHHHHHcccEEEEcEEEEEEEEcccccccccEEEEEEEEEEEEEccccccccccccEEEEEccHHHcccccHHHHHHHHHHHccccccccccc //