[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69134.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:181 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->93 PF01284 * MARVEL 3.3e-05 21.3 75/144  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69134.1 GT:GENE BAC69134.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1757862..1758407) GB:FROM 1757862 GB:TO 1758407 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69134.1 LENGTH 181 SQ:AASEQ MRDHPHDEDVPLTEVWTGRATNRAQWLLALGGAAFLALGVELAVDSAWTSGIAPLVMAVVGCIAAGLLVIFGTLAFVHVAVKVDQDCLEVRCGHIGLPRRRIPLAQVAGAEFVARVTPCQWGGWGYRWRPEKGTAVVVRRGEGVVLRLWDGHTFTITVDNAEAAVRIIRDRLHSTIPGAAH GT:EXON 1|1-181:0| TM:NTM 2 TM:REGION 23->45| TM:REGION 55->77| SEG 24->43|aqwllalggaaflalgvela| SEG 136->148|vvvrrgegvvlrl| HM:PFM:NREP 1 HM:PFM:REP 19->93|PF01284|3.3e-05|21.3|75/144|MARVEL| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------1-----------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 174-181| PSIPRED ccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEccccEEEEEccccccccccccccccccEEEEEEcccEEcccEEEEEccccEEEEEEcccEEEEEEccccEEEEEEEcHHHHHHHHHHHHccccccccc //