[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69138.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69138.1 GT:GENE BAC69138.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1762252..1762692 GB:FROM 1762252 GB:TO 1762692 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69138.1 LENGTH 146 SQ:AASEQ MTSPRSTYGGGYYSASPFPDTPIYDSLVAERGTPQIAPIRVPSAYDASNNLPALPSALPALPAGPSQQVPAYGYPQAQQPAPLQQAPTAYIPQQAAAPRGYPGAQPQQPRPMAAGTGYEAMRPAAPRPAPAPYQDPYNNGQQYRGY GT:EXON 1|1-146:0| SEG 47->63|asnnlpalpsalpalpa| SEG 67->90|qqvpaygypqaqqpaplqqaptay| SEG 120->132|amrpaaprpapap| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 60-76, 99-117, 140-143, 145-146| PSIPRED ccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //