[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69140.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:201 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   140->185 PF10086 * DUF2324 0.00017 20.0 45/223  
:HMM:PFM   24->72 PF11361 * DUF3159 0.00012 31.2 48/188  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69140.1 GT:GENE BAC69140.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1763811..1764416 GB:FROM 1763811 GB:TO 1764416 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAC69140.1 LENGTH 201 SQ:AASEQ MRAIGGLWRWRHNPLRRTTDLIEAWVTLTALLLILVAVPVIGAVVGAVAQDALQQSVRDQHRARHETVATVVKKLNRGPLDPDPETSSARDAHSRVLAAWTGPDGSAHHGAVLADLKTPHRGDHFTLWTDQQGRMVGRPLDTATATTHAMLAGFGAAAMSAGLVEGGRRLIVWRMVRRRYARWDQAWDRAGPDWGRTGAGS GT:EXON 1|1-201:0| TM:NTM 1 TM:REGION 25->47| SEG 26->49|vtltalllilvavpvigavvgava| SEG 168->179|rrlivwrmvrrr| HM:PFM:NREP 2 HM:PFM:REP 140->185|PF10086|0.00017|20.0|45/223|DUF2324| HM:PFM:REP 24->72|PF11361|0.00012|31.2|48/188|DUF3159| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------121----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 54-63, 78-94, 111-114, 196-201| PSIPRED ccccccHHHHcccccccccHHHHHHHHHHHHHHHHEEEccccHHHHHHHHHHHHHHHHHHHHHHccccEEHHHHccccccccccccccccccccEEEEEEEcccccccccEEEccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //