[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69143.1
DDBJ      :             putative DeoR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  549/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.124.1
:276 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   11->61 1bibA PDBj 6e-08 15.7 %
:RPS:PDB   42->250 3dlxB PDBj 1e-27 15.8 %
:RPS:SCOP  9->63 1lvaA4  a.4.5.35 * 2e-09 18.2 %
:RPS:SCOP  85->254 1ks2A1  c.124.1.4 * 7e-20 16.2 %
:HMM:SCOP  8->65 1stzA1 a.4.5.51 * 2e-12 46.6 %
:HMM:SCOP  80->250 1lk5A1 c.124.1.4 * 9e-31 31.9 %
:RPS:PFM   30->63 PF08220 * HTH_DeoR 5e-07 61.8 %
:RPS:PFM   86->246 PF00455 * DeoR 8e-28 41.6 %
:HMM:PFM   85->246 PF00455 * DeoR 4.7e-38 40.3 154/157  
:HMM:PFM   12->63 PF08220 * HTH_DeoR 5.6e-20 48.1 52/57  
:BLT:SWISS 29->269 AGAR_ECOLI 3e-37 36.2 %
:PROS 12->46|PS00894|HTH_DEOR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69143.1 GT:GENE BAC69143.1 GT:PRODUCT putative DeoR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1769668..1770498 GB:FROM 1769668 GB:TO 1770498 GB:DIRECTION + GB:PRODUCT putative DeoR-family transcriptional regulator GB:NOTE PF00455: Bacterial regulatory proteins, deoR family GB:PROTEIN_ID BAC69143.1 LENGTH 276 SQ:AASEQ MSENQNLLAEQRRALILDEVRRRGGVRVNELTRKLGVSDMTVRRDLDALARQGVLEKVHGGAVPVVEASTHEPGFEAKSGLELTAKEDIARAAAELVAPGTAIALSGGTTTYALAHQLVDVPDLTVVTNSVRVADVFHAAQRTSGQRQGAATVVLTGGVRTPSDSLVGPVADQAIVALHFDVLFLGVHGISVEAGLSTPNLAEAETNRRLVQSARRVVVVADHTKWGTVGLSSFASLDQVDTLVTDAGLPAGARAEVSEHLRRLVVAGEPGDGTDI GT:EXON 1|1-276:0| BL:SWS:NREP 1 BL:SWS:REP 29->269|AGAR_ECOLI|3e-37|36.2|232/269| PROS 12->46|PS00894|HTH_DEOR_1|PDOC00696| SEG 20->28|vrrrggvrv| RP:PDB:NREP 2 RP:PDB:REP 11->61|1bibA|6e-08|15.7|51/294| RP:PDB:REP 42->250|3dlxB|1e-27|15.8|203/465| RP:PFM:NREP 2 RP:PFM:REP 30->63|PF08220|5e-07|61.8|34/56|HTH_DeoR| RP:PFM:REP 86->246|PF00455|8e-28|41.6|154/157|DeoR| HM:PFM:NREP 2 HM:PFM:REP 85->246|PF00455|4.7e-38|40.3|154/157|DeoR| HM:PFM:REP 12->63|PF08220|5.6e-20|48.1|52/57|HTH_DeoR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF08220|IPR001034| GO:PFM GO:0005622|"GO:intracellular"|PF08220|IPR001034| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08220|IPR001034| RP:SCP:NREP 2 RP:SCP:REP 9->63|1lvaA4|2e-09|18.2|55/60|a.4.5.35| RP:SCP:REP 85->254|1ks2A1|7e-20|16.2|142/146|c.124.1.4| HM:SCP:REP 8->65|1stzA1|2e-12|46.6|58/87|a.4.5.51|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 80->250|1lk5A1|9e-31|31.9|144/150|c.124.1.4|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 2118 OP:NHOMOORG 555 OP:PATTERN ------------------------2--1---------------------------------------- 33--9322445111-------3---5------322212231--2822-13337461-4--223675A667311111112---1--------1--------13--14-6-B--------------------------22211----------------------------1-------------321--22-31433333334243333375442434411123236666666A2222222222222224322342-1481-32233--881311--3433343333433444444444444444444444444433111333551167332334353413--24422112-2121----1--1--42224222--12--------1-112---1311144444444446---1--2121B--C665456A98562----3224134422111111114222---4-------------------------------1---111113445432333344663333134352232--1211-1111-1324-------411111111----1---2---12--1---1-------11-----1-----------------------------5382-1111223111111122211111111-------------8587664BA9CBCCCBB-ACBBABABABADBABBCB6DCD56432C9DCCCDCCBCCBCCCA988BBA93-766666556666---------------135333737123225775----------3133231534211112455----------333633333533562211111----------4---------------------1---1-1-------1-------41--13111-11 -------------2------------------------------------------------------------------------------------------------------------------------------------------------1----1------4---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 264 STR:RPRED 95.7 SQ:SECSTR ######cHHHEEEEEcTTccEEEEEEETTTTEEEEEETTEEEcEEEcTTcccGGGccccGGGccEEEEcccccccccccccccHHHHHHHHHHGGGccTTEEEEEcTTHHHHHGGGccTTTccEEEEETTTEEEEcEcccccGGGccTTcTTcccTTccEEEEEEccHHHHHHHHHTTcccEEEEcccEEETTccEEcccccccTTHHHHTccTTcEEEEEGEEcEEccccccccccccccEEEcccEEEEEETTEEETTEEEEEEEcTT###### DISOP:02AL 1-11, 270-276| PSIPRED ccccccccHHHHHHHHHHHHHHcccEEHHHHHHHHcccHHHHHHHHHHHHccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHccccEEEEEccHHHHHHHHHccHHHccccccEEEEEccEEEcccccEEcHHHHHHHHHccccEEEEEEcEEccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEccccccEEEEcccccHHHHHHHHHcccEEEEEccccccccc //