[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69144.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   24->159 3cnwA PDBj 4e-10 12.9 %
:RPS:SCOP  21->145 3cnwA1  d.129.3.8 * 3e-12 20.3 %
:HMM:SCOP  17->157 1z94A1 d.129.3.5 * 5.1e-20 25.6 %
:RPS:PFM   25->155 PF10604 * Polyketide_cyc2 7e-05 33.6 %
:HMM:PFM   23->154 PF10604 * Polyketide_cyc2 6.2e-24 28.6 126/139  
:BLT:SWISS 8->126 Y2604_MYCBO 1e-10 33.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69144.1 GT:GENE BAC69144.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1770611..1771090 GB:FROM 1770611 GB:TO 1771090 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF03364: Streptomyces cyclase/dehydrase GB:PROTEIN_ID BAC69144.1 LENGTH 159 SQ:AASEQ MARRLRPVGLDFTQIAPVCLVFAREVAAPPKTVFRALAEDVGGWSEWFGAVTSARPVEDGAGREVRLKGGTRFRETVVVAKPAEVYAYRVDETNAPGMSALLEEWRLTPAGTGTRVQWTFAADGPAVFRFVVNLGRAGLGRAFRDAVTSLDRRLAATRA GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 8->126|Y2604_MYCBO|1e-10|33.1|118/167| RP:PDB:NREP 1 RP:PDB:REP 24->159|3cnwA|4e-10|12.9|132/139| RP:PFM:NREP 1 RP:PFM:REP 25->155|PF10604|7e-05|33.6|128/141|Polyketide_cyc2| HM:PFM:NREP 1 HM:PFM:REP 23->154|PF10604|6.2e-24|28.6|126/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 21->145|3cnwA1|3e-12|20.3|123/138|d.129.3.8| HM:SCP:REP 17->157|1z94A1|5.1e-20|25.6|133/0|d.129.3.5|1/1|Bet v1-like| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----1----------11----1----------2111-------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 88.1 SQ:SECSTR ###################EEEEEEEcccHHHHHHHHcTcTTcGGGTcTTccEEEEEGGGTEEEEEcTTccEEEEEEEEETTTTEEEEEEEccccEEEEEEEEEEEEcccTTcEEEEEEEEEEEccccTccHHHHHHHHHHHHHHHHHHHHHHHHcccc DISOP:02AL 1-3, 158-159| PSIPRED cccccccccccEEccccEEEEEEEEEcccHHHHHHHHHcccccHHHHHHHHcccccccccccEEEEEcccEEEEEEEEEEcccEEEEEEEEccccHHHHHHHHHcEEEEcccccEEEEEEccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHccc //