[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69146.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69146.1 GT:GENE BAC69146.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1772634..1772957 GB:FROM 1772634 GB:TO 1772957 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69146.1 LENGTH 107 SQ:AASEQ MAEPEFTATGVRIGKRLRSLTRAGQVRISGGRLELLTSYGSEIDSAPVQAVRASKPWFAPEDRALADVNGTRYSLTLGEHDPAPGKPGPPSARRFIEAVRKASGRRS GT:EXON 1|1-107:0| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 81-89, 103-107| PSIPRED cccccccHHHHHHHHHHHHHHHccEEEEccccEEEHHHHccccccccccEEEcccccccccccEEEcccccEEEEEEccccccccccccHHHHHHHHHHHHHccccc //