[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69147.1
DDBJ      :             putative regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   47->151 2btzA PDBj 2e-04 15.2 %
:HMM:SCOP  2->133 1l0oA_ d.122.1.3 * 2.7e-09 19.4 %
:HMM:PFM   44->130 PF02518 * HATPase_c 6.6e-10 23.0 87/111  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69147.1 GT:GENE BAC69147.1 GT:PRODUCT putative regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1773206..1773721 GB:FROM 1773206 GB:TO 1773721 GB:DIRECTION + GB:PRODUCT putative regulatory protein GB:NOTE PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase GB:PROTEIN_ID BAC69147.1 LENGTH 171 SQ:AASEQ MISKPSRHCTVELQALPSRIGQVRRIVSAQLRYWHLDPLIDQAALGVTELLSNVHRHAQPDKTCIVEMELLLDRLTVSVHDHDPRLPVVRDAEPSATSGRGLAMVAAVSESWGVRPEGESGKVVWFTLPAPSATALPTRPPRDIGRPVPVLRRAVDGRRSEHAPARSAVAG GT:EXON 1|1-171:0| RP:PDB:NREP 1 RP:PDB:REP 47->151|2btzA|2e-04|15.2|105/357| HM:PFM:NREP 1 HM:PFM:REP 44->130|PF02518|6.6e-10|23.0|87/111|HATPase_c| HM:SCP:REP 2->133|1l0oA_|2.7e-09|19.4|129/141|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 62 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----6-------------------------------1----3437-------------------2--FC81---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 61.4 SQ:SECSTR ##############################################HHHHHHHHHHHHHHTTTTcEEEEEcccEEEEEEEEccccccHHTcTTTTcccccHHHHHHHHHHHTTEEEETTTEEEEEEEEETTTcccccccccHHHHGGGccc#################### DISOP:02AL 1-2, 154-171| PSIPRED cccccccEEEEEEcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHcccEEcccccEEEEEEEEccccccccccccHHHccccccccccccccccccccccccccc //