[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69148.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   58->88 PF09851 * DUF2078 3e-04 51.6 %
:HMM:PFM   9->90 PF09851 * DUF2078 3.6e-22 31.9 69/73  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69148.1 GT:GENE BAC69148.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1773932..1774243) GB:FROM 1773932 GB:TO 1774243 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAC69148.1 LENGTH 103 SQ:AASEQ MQTLANWDGGPGPWIPFFPLIWAAVVIGVVTVLRRTVRRGRGGPWGGGAWGAMGDGRPTGDSPIAVLGRRFASGEIDEDEYWRRLSVLDEQFGRLGKGGAASV GT:EXON 1|1-103:0| TM:NTM 1 TM:REGION 13->33| SEG 23->57|aavvigvvtvlrrtvrrgrggpwgggawgamgdgr| RP:PFM:NREP 1 RP:PFM:REP 58->88|PF09851|3e-04|51.6|31/76|DUF2078| HM:PFM:NREP 1 HM:PFM:REP 9->90|PF09851|3.6e-22|31.9|69/73|DUF2078| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 99-103| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccc //