[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69150.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69150.1 GT:GENE BAC69150.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1775061..1775645 GB:FROM 1775061 GB:TO 1775645 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69150.1 LENGTH 194 SQ:AASEQ MHAMQYELTLPADYDMDIIRSRVSRLGHALDHWDGLGFKAYLMRERGVDGSPVNQYAPFYLWNTVEGMNSFLWGGAFQGIVDDFGRPPVQQWTGLSYEEGGAAGSPARVAVRHRRRVPEGARLTGLMQDAVREAQQLAALDGVVGAAAAVDPRRWELVHFSLWEHDAPKAAGEVFQVLHLSAPGRASLPRGRQW GT:EXON 1|1-194:0| SEG 107->117|arvavrhrrrv| SEG 137->151|laaldgvvgaaaavd| OP:NHOMO 50 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------1--1----------------------111----------------------------------------------------------------------------------------------------------------------------111111111111111------11-------------------1-11-11---11--------------------------------------1--------------------------1-------------1--------------------------------------------1-------------------------------------------------1---11-111--1-----------------------------------------------------------------------1111----------------1-----------------------------1--------------------------------------------------------------------------1-----------------------------------------------1------------------------------------------------------1-------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 190-194| PSIPRED cccEEEEEEccccccHHHHHHHHHHccccccccccccEEEEEEEEccccccEEccEEEEEEEccHHHHHHHHccccHHHHHHHHccHHHHHcccEEEEcccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEcccEEEEEEEEEccccccHHHHEEEEEEEccccHHcccccccc //