[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69151.1
DDBJ      :             putative phosphotriesterase-family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->252 3f4cA PDBj 3e-16 27.5 %
:RPS:PDB   4->252 1dpmA PDBj 1e-11 22.0 %
:RPS:SCOP  14->298 1bf6A  c.1.9.3 * 1e-52 21.8 %
:HMM:SCOP  3->304 1eywA_ c.1.9.3 * 1.7e-68 36.9 %
:RPS:PFM   14->253 PF02126 * PTE 3e-25 32.5 %
:HMM:PFM   17->298 PF02126 * PTE 2.2e-39 31.0 281/308  
:BLT:SWISS 54->254 PTER_RAT 8e-13 27.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69151.1 GT:GENE BAC69151.1 GT:PRODUCT putative phosphotriesterase-family protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1775639..1776550 GB:FROM 1775639 GB:TO 1776550 GB:DIRECTION + GB:PRODUCT putative phosphotriesterase-family protein GB:NOTE PF02126: Phosphotriesterase family GB:PROTEIN_ID BAC69151.1 LENGTH 303 SQ:AASEQ MVSTVRTVLGDVLPEHLGVCDAHDHLFFGSPQLPGQELRDASAARAELAAFREQGGGSVVQWTPYGLGRRAADLPLLSRDTGVHVVAATGLHQAVHYDAGTLAELRGRLADTFVAELTTGIGPSGVRAGLIKVAGGFHALDAHARWTMTAAAEAHHATGAPIAVHLELGTGALDVLDLLCGESGVPPHRVILGHLNRSPDFTVHRQAAEAGAFLAFDGPSRANHATDWRMPDALRALAEAGFGHRLLLGGDTTTAAARSVNGGPGLPYLLRRLRPRLEQALGKDLVGRIFTENPGRAFGVEWR GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 54->254|PTER_RAT|8e-13|27.4|201/349| SEG 37->53|elrdasaaraelaafre| SEG 149->163|taaaeahhatgapia| SEG 262->277|ggpglpyllrrlrprl| BL:PDB:NREP 1 BL:PDB:REP 4->252|3f4cA|3e-16|27.5|247/323| RP:PDB:NREP 1 RP:PDB:REP 4->252|1dpmA|1e-11|22.0|246/329| RP:PFM:NREP 1 RP:PFM:REP 14->253|PF02126|3e-25|32.5|237/298|PTE| HM:PFM:NREP 1 HM:PFM:REP 17->298|PF02126|2.2e-39|31.0|281/308|PTE| GO:PFM:NREP 3 GO:PFM GO:0008270|"GO:zinc ion binding"|PF02126|IPR001559| GO:PFM GO:0009056|"GO:catabolic process"|PF02126|IPR001559| GO:PFM GO:0016788|"GO:hydrolase activity, acting on ester bonds"|PF02126|IPR001559| RP:SCP:NREP 1 RP:SCP:REP 14->298|1bf6A|1e-52|21.8|284/291|c.1.9.3| HM:SCP:REP 3->304|1eywA_|1.7e-68|36.9|298/330|c.1.9.3|1/1|Metallo-dependent hydrolases| OP:NHOMO 69 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- ----1-----------1----------1---------1111--------1--------11---1---111------------1------------------------------------------------------------------------------------------------------1-----------------------1211-----111----111211------------------------------------------------------------------------------------------------------------------------1------------------1-----------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------1--1-11----111------------1-----11------------------111-111---------------------------------------------------------------------------------------------------------------------------------------------1--1---111--1-11---------------- -------------------------------------------------------------------------------------------------------------------2-1--1---11-----------11------------1----------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 301 STR:RPRED 99.3 SQ:SECSTR ##cEEEETTEEEEGGGGccEEEEEccccccGGGGccHHHHHHHHHHHHHHHHHTTccEEEEcccGGGTccHHHHHHHHHHHTcEEEcEEEcccGccccHHHHTccHHHHHHHHHHHHHTccTTccccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEccGGGTHHHHHHHHHHTTTccGGGEEEccGGGcccHHHHHHHHHTTcEEEEccTTHHccccHHHHHHHHHHHHHTTcGGGEEEccccccEEccccTTHHHHHHHHcTTGGGHHHHTHHHHHHHHHTHHHHHHHccEEc DISOP:02AL 1-2| PSIPRED ccccccEEcccccHHHccEEEccccEEEcccccccHHHccHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHccccEEEEccccccccccHHHHHccHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHccccHHHEEEEEccccccHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHcccccEEEEEEccccccccHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccc //