[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69152.1
DDBJ      :             putative ROK-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  448/915 : Eukaryota  42/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:414 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   80->352 1z05A PDBj 4e-21 30.3 %
:RPS:PDB   88->411 3bp8A PDBj 5e-27 20.6 %
:RPS:SCOP  93->220 2hoeA3  c.55.1.10 * 4e-08 17.2 %
:RPS:SCOP  226->401 2gupA2  c.55.1.10 * 3e-18 22.3 %
:HMM:SCOP  92->223 1z6rA2 c.55.1.10 * 3.8e-16 33.3 %
:HMM:SCOP  224->415 1z6rA3 c.55.1.10 * 1.2e-31 35.7 %
:RPS:PFM   108->284 PF00480 * ROK 7e-21 44.3 %
:HMM:PFM   125->281 PF00480 * ROK 1.6e-23 30.3 145/179  
:HMM:PFM   36->74 PF01047 * MarR 0.00062 33.3 39/59  
:BLT:SWISS 204->405 NAGC_SHIFL 3e-18 34.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69152.1 GT:GENE BAC69152.1 GT:PRODUCT putative ROK-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1776636..1777880) GB:FROM 1776636 GB:TO 1777880 GB:DIRECTION - GB:PRODUCT putative ROK-family transcriptional regulator GB:NOTE PF00480: ROK family GB:PROTEIN_ID BAC69152.1 LENGTH 414 SQ:AASEQ MNGKAGPRVAGEGNTRTRLDRGRGALGPALELVHTGRAPTRAVLTAELGVTRATAGAVAAELEALGLIRVDAHPGAAAGSQGRPSHRLEVAENGPVALAAQVHADGFRAALVGLGGRIVATAPGCETVDADPAKVLGSVVEAGAELLEETGRRCVGAGLAVPSAVAEPEGLALNPLHLAWPAGAPVRQIFAERVRAAGITGPAFAANDVNLAALAEHRHGAGRGSRDLLCVATGHRGVGGALVLDGRLHTGSSGLALEVGHLTVNPEGGRPCHCGSRGCLDVEADPLAFLTAAGRDPGPEVSLLQQANDLIRTQYADPYVRTATQALIDRLGLGLAGLVNILNPDRIILGGLHRTLLDADPDRLRAVVADRSLWGQSGGVPILPCTLDHNSLVGAAELAWQPVLDDPLAALAGT GT:EXON 1|1-414:0| BL:SWS:NREP 1 BL:SWS:REP 204->405|NAGC_SHIFL|3e-18|34.4|189/406| SEG 48->67|lgvtratagavaaelealgl| BL:PDB:NREP 1 BL:PDB:REP 80->352|1z05A|4e-21|30.3|264/396| RP:PDB:NREP 1 RP:PDB:REP 88->411|3bp8A|5e-27|20.6|316/381| RP:PFM:NREP 1 RP:PFM:REP 108->284|PF00480|7e-21|44.3|167/181|ROK| HM:PFM:NREP 2 HM:PFM:REP 125->281|PF00480|1.6e-23|30.3|145/179|ROK| HM:PFM:REP 36->74|PF01047|0.00062|33.3|39/59|MarR| RP:SCP:NREP 2 RP:SCP:REP 93->220|2hoeA3|4e-08|17.2|122/128|c.55.1.10| RP:SCP:REP 226->401|2gupA2|3e-18|22.3|166/175|c.55.1.10| HM:SCP:REP 92->223|1z6rA2|3.8e-16|33.3|126/0|c.55.1.10|1/1|Actin-like ATPase domain| HM:SCP:REP 224->415|1z6rA3|1.2e-31|35.7|185/0|c.55.1.10|1/1|Actin-like ATPase domain| OP:NHOMO 949 OP:NHOMOORG 498 OP:PATTERN --1-------------1-----------1-----------------1--------------111---1 224-B111111111-------2---4------2---1165211336615221545115111444474AC7332223431-112-111-2221-1-1----1----112-2--------------1------11--1-22431114-1111111--11------11112221-------------21--34-312111111111111111333322111111-32133343146-111111111111111111-1-2-11---------111---1-11-1111111111111111111111122111111111-11111211111-1211111111121111-22211-1-312--11--1-511154511-----1---------------------11111111111-11-11--1221-611422245422-----11-1111-11--------1-----------------------------------------------------------------------------------------11-------------------------------------1121111-111-11--1---------------------------322--------1-------1111----1-1--1----------33432313443333344-4334433444434443443443331213333333333333333433433432-422222212222----------------1-----1-------111-----------1-----------------1---------22223333322222------------------111111----------------------------1-------2231113111-11 --------------------------------------------------------------------------------------------------------------3111121111--1132111391-114--11111111-11-111111111---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 343 STR:RPRED 82.9 SQ:SECSTR ####################################################################cTTTGGGcccccEEcccccEEEccTTEEEEEEEEcccEEEEEEEETTccEEEEEEEEcccccccccHHHHHHHHHHHHHHHTTTEEEEEEEEEccEEETTTTEEEEcccccccccccTTTHHHHTTccHccHHcEEEEEHHHHHHHHHHHccTTTTcccEEEEEEccccEEEEEEETTEEccccccccccGGGcccccccccccccccccccTTTccHHHHHHHHHTTTTTccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGGHHHHHHHHHHHHHHHccHHHHTTccEEEccccTTcGGGHHHHHHHHHccTTHHHH### DISOP:02AL 1-26, 71-86| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccccccccccccEEEEEcccccEEEEEEEEccEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEcccEEEccccEEEccccccccccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEEccEEEEccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHcccHHHHccc //