[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69153.1
DDBJ      :             putative DNA repair protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  187/915 : Eukaryota  64/199 : Viruses  0/175   --->[See Alignment]
b.82.2
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->215 3i3qB PDBj 1e-18 38.3 %
:RPS:PDB   13->212 3bkzA PDBj 2e-22 31.1 %
:RPS:SCOP  7->212 2iuwA1  b.82.2.10 * 2e-22 20.7 %
:HMM:SCOP  13->212 2fdiA1 b.82.2.10 * 1.1e-40 34.2 %
:BLT:SWISS 8->50 GLAB1_BACV8 5e-04 34.9 %
:BLT:SWISS 47->215 ALKB_ECOLI 4e-18 38.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69153.1 GT:GENE BAC69153.1 GT:PRODUCT putative DNA repair protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1778014..1778682) GB:FROM 1778014 GB:TO 1778682 GB:DIRECTION - GB:PRODUCT putative DNA repair protein GB:NOTE alkylation damage repair GB:PROTEIN_ID BAC69153.1 LENGTH 222 SQ:AASEQ MDAELFPRSRAQVAPDAVHVPDWADAGRQRRFLAACRDWARPPAGLRTVHTPGGGTMTSRQVCLGWHWYPYGYARTVVDGDGAPVKPLPDWLAELGRDAVSDALGPQAVPPVPYDIALINFYGADARMGMHRDSDEKSGAPVVSLSVGDTCVFRFGNARTRTRPYTDVELRSGDLFVFGGASRLAYHGVPRVYADTAPPELGLVGRLNITLRVSGFQDPSGE GT:EXON 1|1-222:0| BL:SWS:NREP 2 BL:SWS:REP 8->50|GLAB1_BACV8|5e-04|34.9|43/100| BL:SWS:REP 47->215|ALKB_ECOLI|4e-18|38.3|162/216| BL:PDB:NREP 1 BL:PDB:REP 47->215|3i3qB|1e-18|38.3|162/203| RP:PDB:NREP 1 RP:PDB:REP 13->212|3bkzA|2e-22|31.1|190/201| RP:SCP:NREP 1 RP:SCP:REP 7->212|2iuwA1|2e-22|20.7|184/202|b.82.2.10| HM:SCP:REP 13->212|2fdiA1|1.1e-40|34.2|190/0|b.82.2.10|1/1|Clavaminate synthase-like| OP:NHOMO 279 OP:NHOMOORG 251 OP:PATTERN -------------------------------------------------------------------- -11---21111--1-----------------------11--------21---1--1----------11111-----------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------11111---1111-11111111111---1--1-1111-1---1111111111111111----11111111111---1--1---------------------------------1--11111---------------------2--1112--111-111111111-11--1111------------1-----------------------------1----------------------------------1--1-----------------------------------1111-111111111111-111111111111111111111111---1111111111-1111111111111--1------------------------------------------------------------1111-1111-111------------------------------------------------------------------------------------------------- ----11--111-111-1----------------11-------------11------------1-----------------------11-1-11111---1----1---1221-11---11-------------------------------------1---11111-111---11-1126122113114-411-22322 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 94.1 SQ:SECSTR ######ccEEEEccTTcEEETTTTTTTHHHHHHHHHHHHHHccGGccccccTTccccccEEEEEEcccccEEEEcccTTcTccccccccHHHHHHHHHHHHHHTTHTTcTTccccEEEEEEEcTTccEEEEccccccTTccEEEEEEEccEEEEEcccccTTcccEEEEEcTTcEEEEcGGGTTccEEEccccccccTTTcccccEEEEEEEccc####### DISOP:02AL 218-222| PSIPRED ccccccccccHHHcccEEEEcccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccEEEEEEEcccccccccccccccccccEEEEEcccEEEEEEcccccccccEEEEEEccccEEEEccccHHHEEEccccccccccccccccEEEEEEEEEccccccccc //