[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69171.1
DDBJ      :             putative integral membrane transport protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  166/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:399 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->399 1pw4A_ f.38.1.1 * 1.5e-50 25.2 %
:HMM:PFM   30->222 PF07690 * MFS_1 1.1e-20 26.9 193/353  
:HMM:PFM   229->394 PF07690 * MFS_1 5.9e-13 25.9 166/353  
:BLT:SWISS 29->368 Y4WD_RHISN 8e-21 37.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69171.1 GT:GENE BAC69171.1 GT:PRODUCT putative integral membrane transport protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1803393..1804592 GB:FROM 1803393 GB:TO 1804592 GB:DIRECTION + GB:PRODUCT putative integral membrane transport protein GB:NOTE PF07690: Major Facilitator Superfamily GB:PROTEIN_ID BAC69171.1 LENGTH 399 SQ:AASEQ MPQINKTCSPSVVPNTDLTRLRVALTVFFALDGFVFAGWVVRIPAIKEQTGASASTLGLALLGVSAGAVITMMLTGRLCRRFGSHPVTVVCGVLLSVSVALPPLTHSVPALGAVLLVFGAAYGGINVAFNSAAVDLVTALHRPVMPSFHAAFSLGGMVGAGLGGLVAAHLSPTHHLLALTMVGLLVTAVAGRTLLRHEPPVPPDRPRQEEHARRPLDGRTRGLVLVFGLIALCTAFGEGAMADWGALHLEQDLDAHPGVAAAGYSCFALAMTAGRLSGTALLERLGRTRTVVVGGTTAAAGMLLGALAPSVWAALLGFAVTGLGLANLFPVAVERAGALAGPSGVAIASTLGYGGMLLGPPAIGFMADWYSLPAALTSVAALAAVAAAIGFVTRRTTAD GT:EXON 1|1-399:0| BL:SWS:NREP 1 BL:SWS:REP 29->368|Y4WD_RHISN|8e-21|37.3|330/377| TM:NTM 10 TM:REGION 22->44| TM:REGION 55->77| TM:REGION 83->105| TM:REGION 113->135| TM:REGION 145->167| TM:REGION 174->196| TM:REGION 221->240| TM:REGION 313->335| TM:REGION 343->365| TM:REGION 372->393| SEG 50->69|tgasastlglallgvsagav| SEG 93->104|vllsvsvalppl| SEG 108->124|vpalgavllvfgaaygg| SEG 154->168|lggmvgaglgglvaa| SEG 284->308|rlgrtrtvvvggttaaagmllgala| SEG 374->388|aaltsvaalaavaaa| HM:PFM:NREP 2 HM:PFM:REP 30->222|PF07690|1.1e-20|26.9|193/353|MFS_1| HM:PFM:REP 229->394|PF07690|5.9e-13|25.9|166/353|MFS_1| HM:SCP:REP 1->399|1pw4A_|1.5e-50|25.2|397/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 186 OP:NHOMOORG 166 OP:PATTERN -------------------------------------------------------------------- --1-----------1----------------------1121------12---111-------1--111321----------------------------1-2---3-1-1-------------------------------------------------------------------------11----------------------1-----1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------11111111-1----------11--1--112321311------1-111111-------------1-------------------------------------1------11-2--1111---11111-11--------11---1-----------------------------------------------------------1------------------------------------------------------------------------1-1----1111111111-1111111111111111111---11---111111111111111111111111--21111111-111---------------------------------1111111----11212---1-----1111------------------------22----------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 199-218, 397-399| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //