[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69172.1
DDBJ      :             putative MarR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->169 2fbkA PDBj 1e-07 35.1 %
:RPS:PDB   49->169 3bpvA PDBj 4e-16 20.0 %
:RPS:SCOP  63->164 2fbiA1  a.4.5.28 * 8e-20 25.0 %
:HMM:SCOP  13->169 2fbkA1 a.4.5.28 * 4.2e-25 33.1 %
:RPS:PFM   77->134 PF01047 * MarR 8e-09 51.9 %
:RPS:PFM   106->158 PF01638 * HxlR 4e-04 42.9 %
:HMM:PFM   96->136 PF01047 * MarR 3.5e-13 46.3 41/59  
:BLT:SWISS 63->164 MHQR_BACSU 2e-09 30.5 %
:PROS 109->144|PS01117|HTH_MARR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69172.1 GT:GENE BAC69172.1 GT:PRODUCT putative MarR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1804744..1805259) GB:FROM 1804744 GB:TO 1805259 GB:DIRECTION - GB:PRODUCT putative MarR-family transcriptional regulator GB:NOTE PF01047: MarR family GB:PROTEIN_ID BAC69172.1 LENGTH 171 SQ:AASEQ MVSGEVIGKTVHAHALNANAFNSDATNSIFCYRASMAAKKAEQVLVDQWRGILAVHARTLCELDRELHPHGLGASDFEVLDVLAEGAAPDGGSGYRVQEIADRVHLSQSALSRLIGRLEKDGLVTRGMCPEDRRGVQVCLTPKGRALRDEVLPVQRAVLTRMLAGDAAECG GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 63->164|MHQR_BACSU|2e-09|30.5|95/145| PROS 109->144|PS01117|HTH_MARR_1|PDOC00861| BL:PDB:NREP 1 BL:PDB:REP 63->169|2fbkA|1e-07|35.1|97/156| RP:PDB:NREP 1 RP:PDB:REP 49->169|3bpvA|4e-16|20.0|115/137| RP:PFM:NREP 2 RP:PFM:REP 77->134|PF01047|8e-09|51.9|52/59|MarR| RP:PFM:REP 106->158|PF01638|4e-04|42.9|49/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 96->136|PF01047|3.5e-13|46.3|41/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 63->164|2fbiA1|8e-20|25.0|96/136|a.4.5.28| HM:SCP:REP 13->169|2fbkA1|4.2e-25|33.1|154/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 79 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- ----4-----1-1--------1---2-------1124322-11---------1121-1---1123-1452------------------------------------------------------------------111--------------------------------------------1---------------------------111--------1------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------1-----11--------------2-------------------------------------------------------2-1111----------------1------------------------------------------------------------1-------11-1------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 80.7 SQ:SECSTR #################################cccccccHHHHHTcHHHHHHHHHHHHHHHHHHHcGGGTccHHHHHHHHHHHHcTTTTcEETccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHTHHHHHHHHHHHHHHHTTTccHHHH DISOP:02AL 1-8| PSIPRED ccccHHHccHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccccc //