[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69176.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->212 2oi8A PDBj 4e-61 62.8 %
:RPS:PDB   13->121 3cjdA PDBj 3e-09 19.6 %
:RPS:SCOP  7->85 2oi8A1  a.4.1.9 * 2e-13 82.3 %
:RPS:SCOP  86->212 2oi8A2  a.121.1.1 * 1e-07 57.9 %
:HMM:SCOP  4->92 1t33A1 a.4.1.9 * 3e-14 29.5 %
:HMM:SCOP  82->215 1zk8A2 a.121.1.1 * 7.4e-09 25.2 %
:HMM:PFM   23->66 PF00440 * TetR_N 2.9e-13 38.6 44/47  
:BLT:SWISS 9->208 Y1846_MYCBO 8e-23 41.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69176.1 GT:GENE BAC69176.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1808928..1809578) GB:FROM 1808928 GB:TO 1809578 GB:DIRECTION - GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC69176.1 LENGTH 216 SQ:AASEQ MAGVKESPRERYRAQVRSEIKERAWEQIATAGASGLSLNAIAKQLGMSGPALYRYFAGRDELITELIRDAYRSLADAFRAAAESGADLVGLAHAMRDWALGDPQRYFLVYGTPVPGYHAPEDVTAIASEIMSTLLDACAAAPGAAPHGDAFDEHLADHRPWAADHPAPPAVLHTALAFWTRLHGVLSLELAGHFTGMGFDPAALFAAEIDDLSATR GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 9->208|Y1846_MYCBO|8e-23|41.1|197/234| SEG 136->150|dacaaapgaaphgda| BL:PDB:NREP 1 BL:PDB:REP 7->212|2oi8A|4e-61|62.8|196/199| RP:PDB:NREP 1 RP:PDB:REP 13->121|3cjdA|3e-09|19.6|107/177| HM:PFM:NREP 1 HM:PFM:REP 23->66|PF00440|2.9e-13|38.6|44/47|TetR_N| RP:SCP:NREP 2 RP:SCP:REP 7->85|2oi8A1|2e-13|82.3|79/79|a.4.1.9| RP:SCP:REP 86->212|2oi8A2|1e-07|57.9|121/124|a.121.1.1| HM:SCP:REP 4->92|1t33A1|3e-14|29.5|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 82->215|1zk8A2|7.4e-09|25.2|103/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 63 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- ----2---------11111-12---111111-1111--11-315-111-----11--1---21-232322----------------------------------------------------------11---1------1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1--1-----------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 94.9 SQ:SECSTR ######cccccccHHHHHHHHHHHHHHHHHHcGGGccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHTcHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHHHHHHHTcccTTHHHHHHHHHHHHHHTccTTTcHHHHHTHTTT#cccHHHHHHHHHHHH#### DISOP:02AL 1-18| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccc //